PRGDB00048611 (putative NBS-LRR disease resistance protein RIT-5)

From PRG Wiki
Jump to: navigation, search
putative NBS-LRR disease resistance protein RIT-5
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 111608627 (DQ849031)
Gene Class NL
Domain Type NBS, LRR
Gene Species Ipomoea trifida

Comment?

Ipomoea trifida putative NBS-LRR disease resistance protein RIT-5 gene, partial cds.

DNA Sequence

GGAGGCGTGGGAAAGACTACCTTAGTGAAAGCCATATTTAACCAAATTTCTGGAACATTTGAAGGTAGTTGCTTTCTTGATGTTAGATCAAAATATCCAAAGGGAGGGAGTGTAGGTTTAAAATGTTTGCAGAAGCAACTTCTTTGTAATACTCTCGAAACAATGAGAATTGAAGTTAACCATGTTGATGAAGGAATTAGTTTGATCAAATTAAGGCTTAGATCAAAAAGGGTTCTCATTGTTGTTGATAATGTAGAACATGAGAATCAATTAGAGGCATTAGTTGGAGAGAGAGATTGGTTTGGTTCAGGTAGTACAATTCTCATTACAACTAGAAATGTTAATTTGTTGAACGGCTTCGGAAAAGATTGTGAGAAGTACAATGTTGCGGTGTTAAGTTCTAAGGAATCTTTGCAACTCTTTTGTTGGCATGCTTTTTACGACCCAAAATCCTTTGGAGACTTTTGCCGAACTATCAAACGTGATAGTAAGGTATGCTCCATGGGCTTCCTCTGGTTGC


Protein sequences

Name Description Sequence
putative NBS-LRR disease resistance protein RIT-5 putative NBS-LRR disease resistance protein RIT-5 [Ipomoea trifida].

GGVGKTTLVKAIFNQISGTFEGSCFLDVRSKYPKGGSVGLKCLQKQLLCNTLETMRIEVNHVDEGISLIKLRLRSKRVLIVVDNVEHENQLEALVGERDWFGSGSTILITTRNVNLLNGFGKDCEKYNVAVLSSKESLQLFCWHAFYDPKSFGDFCRTIKRDSKVCSMGFLWL


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
1-146 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GGVGKTTLVKAIFNQISGTFEGSCFLDVRSKYPKGGSVGLKCLQKQLLCNTLETMRIEVNHVDEGISLIKLRLRSKRVLIVVDNVEHENQLEALVGERDWFGSGSTILITTRNVNLLNGFGKDCEKYNVAVLSSKESLQLFCWHAF

superfamily: SSF52540
1-147 SSF52540

GGVGKTTLVKAIFNQISGTFEGSCFLDVRSKYPKGGSVGLKCLQKQLLCNTLETMRIEVNHVDEGISLIKLRLRSKRVLIVVDNVEHENQLEALVGERDWFGSGSTILITTRNVNLLNGFGKDCEKYNVAVLSSKESLQLFCWHAFY

HMMPfam: PF00931
IPR002182
1-148 NB-ARC,NBS
NB-ARC

GGVGKTTLVKAIFNQISGTFEGSCFLDVRSKYPKGGSVGLKCLQKQLLCNTLETMRIEVNHVDEGISLIKLRLRSKRVLIVVDNVEHENQLEALVGERDWFGSGSTILITTRNVNLLNGFGKDCEKYNVAVLSSKESLQLFCWHAFYD

HMMPanther: PTHR11017:SF20
1-146 PTHR11017:SF20,SUBFAMILY NOT NAMED

GGVGKTTLVKAIFNQISGTFEGSCFLDVRSKYPKGGSVGLKCLQKQLLCNTLETMRIEVNHVDEGISLIKLRLRSKRVLIVVDNVEHENQLEALVGERDWFGSGSTILITTRNVNLLNGFGKDCEKYNVAVLSSKESLQLFCWHAF

Gene3D: G3DSA:3.40.50.300
2-120 G3DSA:3.40.50.300

GVGKTTLVKAIFNQISGTFEGSCFLDVRSKYPKGGSVGLKCLQKQLLCNTLETMRIEVNHVDEGISLIKLRLRSKRVLIVVDNVEHENQLEALVGERDWFGSGSTILITTRNVNLLNGF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox