PRGDB00048612 (putative NBS-LRR disease resistance protein RIT-4)

From PRG Wiki
Jump to: navigation, search
putative NBS-LRR disease resistance protein RIT-4
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 111608625 (DQ849030)
Gene Class NL
Domain Type NBS, LRR
Gene Species Ipomoea trifida

Comment?

Ipomoea trifida putative NBS-LRR disease resistance protein RIT-4 gene, partial cds.

DNA Sequence

GGGGTGGGGAAAACAACCCTAGCAAAAGCCGTATTTAATGAAATTTGTGAAACATTTGAAGGTAGTTGCTTTCTTGCAGATGTTAGATCAAAATGTTTGGACGGATATAGTGCAGGTTTAAGACATTTACAGACGCAACTTCTTTGTAAAACTCTTGAGACAACTAGATTTGATGTTGATCATGTTAATGAAGGAATTAGTTTGATCAAATTAAGACTCGGATTAAAAAAACTGCTCATTGTTGTTGATGATGTAGACCACGAGAGTCAATTAGATGCATTAGTAGGAGAGCGAGATTGGTTTGGTTCAGGCAGTACAATTATCATCATAACTAGACATGTTAATTTGCTGAATGGCCCTGGAAAAGATTATGAAAAGTACAAAGTTGAAGTGTTAAGCTCCAAGGAATCTTTGCAACTCTTTAGCTTGTATGCTTTTAATAATCCAAACCCTTCGGAGGCTTTTGTAGAGCTATCAAACATGATAGTGAGTTGTGTTGGGGGACTTCCTCTGGCT


Protein sequences

Name Description Sequence
putative NBS-LRR disease resistance protein RIT-4 putative NBS-LRR disease resistance protein RIT-4 [Ipomoea trifida].

GVGKTTLAKAVFNEICETFEGSCFLADVRSKCLDGYSAGLRHLQTQLLCKTLETTRFDVDHVNEGISLIKLRLGLKKLLIVVDDVDHESQLDALVGERDWFGSGSTIIIITRHVNLLNGPGKDYEKYKVEVLSSKESLQLFSLYAFNNPNPSEAFVELSNMIVSCVGGLPLA


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF20
1-172 PTHR11017:SF20,SUBFAMILY NOT NAMED

GVGKTTLAKAVFNEICETFEGSCFLADVRSKCLDGYSAGLRHLQTQLLCKTLETTRFDVDHVNEGISLIKLRLGLKKLLIVVDDVDHESQLDALVGERDWFGSGSTIIIITRHVNLLNGPGKDYEKYKVEVLSSKESLQLFSLYAFNNPNPSEAFVELSNMIVSCVGGLPLA

HMMPfam: PF00931
IPR002182
1-172 NB-ARC,NBS
NB-ARC

GVGKTTLAKAVFNEICETFEGSCFLADVRSKCLDGYSAGLRHLQTQLLCKTLETTRFDVDHVNEGISLIKLRLGLKKLLIVVDDVDHESQLDALVGERDWFGSGSTIIIITRHVNLLNGPGKDYEKYKVEVLSSKESLQLFSLYAFNNPNPSEAFVELSNMIVSCVGGLPLA

HMMPanther: PTHR11017
1-172 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

GVGKTTLAKAVFNEICETFEGSCFLADVRSKCLDGYSAGLRHLQTQLLCKTLETTRFDVDHVNEGISLIKLRLGLKKLLIVVDDVDHESQLDALVGERDWFGSGSTIIIITRHVNLLNGPGKDYEKYKVEVLSSKESLQLFSLYAFNNPNPSEAFVELSNMIVSCVGGLPLA

Gene3D: G3DSA:3.40.50.300
1-119 G3DSA:3.40.50.300

GVGKTTLAKAVFNEICETFEGSCFLADVRSKCLDGYSAGLRHLQTQLLCKTLETTRFDVDHVNEGISLIKLRLGLKKLLIVVDDVDHESQLDALVGERDWFGSGSTIIIITRHVNLLNG

superfamily: SSF52540
1-172 SSF52540

GVGKTTLAKAVFNEICETFEGSCFLADVRSKCLDGYSAGLRHLQTQLLCKTLETTRFDVDHVNEGISLIKLRLGLKKLLIVVDDVDHESQLDALVGERDWFGSGSTIIIITRHVNLLNGPGKDYEKYKVEVLSSKESLQLFSLYAFNNPNPSEAFVELSNMIVSCVGGLPLA






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox