PRGDB00048627 (Disease resistance protein RPP8, putative, expressed)

From PRG Wiki
Jump to: navigation, search
Disease resistance protein RPP8, putative, expressed
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 108863896 (DP000010)
Gene Class NL
Domain Type LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, LRR, NBS
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) chromosome 11, complete sequence.

DNA Sequence

ATGTGGTGGTATAAACCCAACAATGAATGGTCCAAGGTTTATGACTCTATTGGGTTTGGACAAGAAGACAGCAAGGATGTTCGGAACACAAGAAAGATATTGCCTTTTAGCTATTACGATCTACCCATTCAATTAAGGACTTGCTTATTGTATCTATCCATATTTCCAGAAGATTATTGGATTGAGAAATACCAATTGATTTGGAGATGGATAGCTGAAGGTTTTGTCCACGAGGAAAAGGGGCTAGTGTTATTTGAGCAGGGGGAGAGATTCCTCGACGAGCTGATAAATAGAAGCTTAATCCAGCCATCAGATCGTTATCATAGTGGTATTGTAAATGGCTGTCGTGTTCATGACATGGTGCTTGATCTCATTCGTTCCTTGTCGAGTGAAGAGAATTTTTGTGCTATGCTGCATAAGGAACAAACCATGCTTTCACAGAACAACATTGTCCGCAGGTTAGCCATCCACAAAAGAATTCTAGAGCATAACCCTAAGATGAATGTGCGCATGGCACAAGTGAGGTCATTCAATGCCTACATGTGCGGTCATATGGATTGTATGCCCCCGCTATGGAGCTTTAAAGTTGTGCGCGTGTTAGTCTTAGATTTATGTAATTTTACGGGAAGTCCTCATCTTGAGCCTATTGGGAAATTGCTTCACCTCAAGTACCTAGGACTAGTGAACACGGCCATTGCTGAGCTCCCCAAGGAGGTTGGGAACCTCACATTGTTGCAGACGTTAGACATATGGCGCACTAGTATAGAAGAACTTCCATCAACTGTTGGTAAGCTGAAGCGGCTGATCTGCCTGCGAGCTGACAGCAACACGAGAGTGCCAGCGGGGGTGATAGGGAGCTTAACATCCCTACAGCAACTGCGCCTTCACTCTGCTGACAAGTCCCCGAGCGCCGTTGTAGAGCTAGGTAAGCTGGTGGAGCTAAGAGTGCTTGAAATCCAGTTCTGCAAGATGGATCAGAACTCACGGAGATCTCTAGTGGAATCCGTGTGCAACCTTTGCAACATACAAGTTCTCGAAGTTCACTATGATCACTCTGGACCTACAGAGTGGGCGTACCTAGGTAGCAGCTGGGAAGGCTGGGTGCCCCATCCACGGCTCCGCCAGTTCTTGCTGAGAGCCATCTCTCTGCCATGA


Protein sequences

Name Description Sequence
Disease resistance protein RPP8, putative, expressed Disease resistance protein RPP8, putative, expressed [Oryza sativa (japonica cultivar-group)].

MWWYKPNNEWSKVYDSIGFGQEDSKDVRNTRKILPFSYYDLPIQLRTCLLYLSIFPEDYWIEKYQLIWRWIAEGFVHEEKGLVLFEQGERFLDELINRSLIQPSDRYHSGIVNGCRVHDMVLDLIRSLSSEENFCAMLHKEQTMLSQNNIVRRLAIHKRILEHNPKMNVRMAQVRSFNAYMCGHMDCMPPLWSFKVVRVLVLDLCNFTGSPHLEPIGKLLHLKYLGLVNTAIAELPKEVGNLTLLQTLDIWRTSIEELPSTVGKLKRLICLRADSNTRVPAGVIGSLTSLQQLRLHSADKSPSAVVELGKLVELRVLEIQFCKMDQNSRRSLVESVCNLCNIQVLEVHYDHSGPTEWAYLGSSWEGWVPHPRLRQFLLRAISLP


Domains

Domain Start-End Description Sequence

HMMPfam: PF00931
IPR002182
8-80 NB-ARC,NBS
NB-ARC

NEWSKVYDSIGFGQEDSKDVRNTRKILPFSYYDLPIQLRTCLLYLSIFPEDYWIEKYQLIWRWIAEGFVHEEK

HMMPanther: PTHR23155:SF194
10-317 PTHR23155:SF194,OS11G0130900 PROTEIN

WSKVYDSIGFGQEDSKDVRNTRKILPFSYYDLPIQLRTCLLYLSIFPEDYWIEKYQLIWRWIAEGFVHEEKGLVLFEQGERFLDELINRSLIQPSDRYHSGIVNGCRVHDMVLDLIRSLSSEENFCAMLHKEQTMLSQNNIVRRLAIHKRILEHNPKMNVRMAQVRSFNAYMCGHMDCMPPLWSFKVVRVLVLDLCNFTGSPHLEPIGKLLHLKYLGLVNTAIAELPKEVGNLTLLQTLDIWRTSIEELPSTVGKLKRLICLRADSNTRVPAGVIGSLTSLQQLRLHSADKSPSAVVELGKLVELRVL

HMMPanther: PTHR23155
10-317 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

WSKVYDSIGFGQEDSKDVRNTRKILPFSYYDLPIQLRTCLLYLSIFPEDYWIEKYQLIWRWIAEGFVHEEKGLVLFEQGERFLDELINRSLIQPSDRYHSGIVNGCRVHDMVLDLIRSLSSEENFCAMLHKEQTMLSQNNIVRRLAIHKRILEHNPKMNVRMAQVRSFNAYMCGHMDCMPPLWSFKVVRVLVLDLCNFTGSPHLEPIGKLLHLKYLGLVNTAIAELPKEVGNLTLLQTLDIWRTSIEELPSTVGKLKRLICLRADSNTRVPAGVIGSLTSLQQLRLHSADKSPSAVVELGKLVELRVL

superfamily: SSF52058
116-349 SSF52058,LRR

RVHDMVLDLIRSLSSEENFCAMLHKEQTMLSQNNIVRRLAIHKRILEHNPKMNVRMAQVRSFNAYMCGHMDCMPPLWSFKVVRVLVLDLCNFTGSPHLEPIGKLLHLKYLGLVNTAIAELPKEVGNLTLLQTLDIWRTSIEELPSTVGKLKRLICLRADSNTRVPAGVIGSLTSLQQLRLHSADKSPSAVVELGKLVELRVLEIQFCKMDQNSRRSLVESVCNLCNIQVLEVHY

Gene3D: G3DSA:3.80.10.10
188-349 G3DSA:3.80.10.10

MPPLWSFKVVRVLVLDLCNFTGSPHLEPIGKLLHLKYLGLVNTAIAELPKEVGNLTLLQTLDIWRTSIEELPSTVGKLKRLICLRADSNTRVPAGVIGSLTSLQQLRLHSADKSPSAVVELGKLVELRVLEIQFCKMDQNSRRSLVESVCNLCNIQVLEVHY


List of References


The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
BMC Biol.: 2005, 3();20
PubMed:16188032 WorldCat.org DOI (I e)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox