PRGDB00048629 (NBS-LRR type disease resistance protein, putative, expressed)

From PRG Wiki
Jump to: navigation, search
NBS-LRR type disease resistance protein, putative, expressed
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 108863896 (DP000010)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) chromosome 11, complete sequence.

DNA Sequence

GTAATGCTGCTAAACTTGCTTGTCTAAGGTTCTGCACATTGACCGTACAGCACCTGCGCTCCAGCCCTGTTCTCTGGTCTTCCAGCAGTATCACCCGAAGATCGCGAAGAACTCCTCCTTCTCTCGATTTCGATCCGCATTCCGTTGACGGATTGATGGCAGAGGCGGTCCTCCTTGCTCTAACGAAGATCGGTGATGCTTTAGCAAATGAAATCGCTAAAGAATTGATTGCCAAACTGTCTGAAAAGGTTAATAATCTAAAGGATCTGGATGAGAAGATTGAGCAAATGAGGAAACAATTGACAACCATGAACAACGTTATATTGCAGATAGGCACGACATACCTCACTGATGAAGTCGTCAAGGGTTGGATTGGGGAGGTAAGGAAGGTGGCCTACCGTGTTGAGGATGTCATGGACAAATACTCGTATTACTCTGTGCAAATGGCGGAAGAGTGGTTCCTTAAAAAATACTTCATCAAAGCATCACATTATGTTATTGTTTTCACTGAAATTGCTAATGAGGTAGTCAAGATAGAGAAGGAAATCAAACAAGTTATAGAACTGAAGGATCAGTGGTTGCATCCATCCCAGCTTGTTTCTGACCCGCTCACTGAGATGGAAAGACAGAGGTCCCGGGACAGCTTCCCAGAACTTGTGAAAGATGAAGATCTTGTGGGGATTGAAGACAACAGGAGACTGCTGACTGAATGGTTGTACACCGACGAGCTGGACAGTAAGGTGATAACAGTGTCAGGTATGGGCGGACTGGGGAAAACCACCCTGGTCACAAATGTGTATGAACGTGAAAAGATCAACTTCTCTGCTCATGCATGGATGGTTGTGTCTCAAACCTACACTGTGGATGCTCTATTAAGGAAGCTGCTTTGGAAAGTTGGTTACACAGAACCACCACTGTCAAGTAACATTGACAAAATGGATGTGTATGATTTGAAAGAGGAAATAAAGCGAATGCTCAAAGTTAGAAAATGCTTGATCGTACTTGATGATGTCTGGGACCAAGAAGCATACTTTCAAATACGTGATGCATTCCAGAATGACCAAGGAAGTCGCGTAATAATCACAACACGGAAGAATCATGTGGCAGCTCTTGCTTCCTCAACATGTCACCTTGATCTCCAGCCATTGAGTGATATTCATGGCTTTGATCTATTCTGCAGAAGGGCATTTTATAACATTAAGGACCATGAGTGTCCCACGGAACTCGTGAAAGTTGCCAAATCTATAGTTGAGCGGTGTCAGGGCCTTCCACTAGCAATTGTGTCAATAGGCTGCCTCCTGTCTTCAAGATCACGGTCACATTATGTTTGGAATCAAGCATACAATCAACTTAGAAGTGAGTTGTCAAAGAACAATCATGTCCGAGCAATTTTAAATATGAGCTACCATGACCTGTCAGGAGACCTAAGAAACTGCTTTTTGTACTGCAGCCTATTCCCGGAAGACTACCCGCTCTCCCGTGAGAGCCTTGTGCGTCTGTGGATTGCAGAAGGCTTTGTCCTGAGGAAAGAGAACAACACACCAGAGGCAGTAGCTGAGGGAAATCTCATGGAATTGATATACAGGAATATGCTTCAAGTTACAGAGTATGATGATCTCGGCAGGGTGAATACTTGTGGAATGCATGACATTATGCGAGACCTGGCCCTTTCTGCTGCTAAAGAGGAGAAGTTTGGCTCTGCAAATGATTTTGGCACAATGGTAGAGATTGATAAGGATGTTCGTCGTCTGTCAACTTACCGATGGAAAGACAGTACTGCACCAATTCTCAAACTTCTACGTCTTCGAACCATAGTATCACTTGAAGCATTTTCATCTTCCATTGATATGTTGTCCTCAGTTTTGTCTCACTCAAGCTACCTTACTGTTCTCGAGCTTCAAGATTCAGAAATCACTCAAGTTCCACCATCTATAGGGAATTTGTTTAATCTACGTTACATTGGCTTACGGAGGACCAAGGTTAAGTCACTCCCAGACTCCATTGAAAAGTTGCTGAACCTCCACACTCTGGACATGAAGCAAACAAAGATAGAGAAGCTACCACGAGGAATCACTAAAATCAAGAAGCTAAGACACTTGTTTGCTGATAGATGTGTTGACGAGAAGCAGTCGGAGTTCCGATACTTTGTAGGAATGCAGGCACCTAAAGATCTATCCAACCTGAAAGAACTACAAACTCTGGAGACTGTTGAAGCCAGCAAGGACTTAGCTGAGCAGTTGAAGAAACTCATACAACTAAAAAGTGTATGGATTGACAACATAAGCTCTGCTGATTGTGATAATATTTTTGCTACACTGTCAAATATGCCGCTACTTTCCAGTTTGCTTCTTTCTGCAAGGAATGAGAATGAGCCACTTTCTTTTGAGGCTCTCAAGCCAAGTTCCACAGAACTCCACAGGTTAATTGTCAGAGGGCAATGGGCCAAGAGTACATTGGACTACCCGATATTCCGTAGCCACAGTACACATCTCAAATATTTATCCCTAAGTTGGTGTCATCTCGGGGAAGATCCATTGGGGATGCTTGCGTCGAACTTGTCGGACCTCACTTATCTAAAACTGAACAACATGCAGAGTGCAGCAACATTAGTTCTTCGTGCAAAGGCATTCCCCAAACTAAAGACTCTTGTCTTGAGGCAGATGCCTGATGTCAAGCAGATAAAGATCATGGATGGCGCCCTTCCATGCATTGAATGTTTGTACATTGTGTTGCTGCCGAAGCTGGACAAGGTCCCTCAAGGCATTGAGTCCCTTAACTCCCTGAAGAAGCTCTCCCTGTTGAACCTGCATAAAGACTTCAAAATCCAATGGAATG


Protein sequences

Name Description Sequence
NBS-LRR type disease resistance protein, putative, expressed NBS-LRR type disease resistance protein, putative, expressed [Oryza sativa (japonica cultivar-group)].

MAEAVLLALTKIGDALANEIAKELIAKLSEKVNNLKDLDEKIEQMRKQLTTMNNVILQIGTTYLTDEVVKGWIGEVRKVAYRVEDVMDKYSYYSVQMAEEWFLKKYFIKASHYVIVFTEIANEVVKIEKEIKQVIELKDQWLHPSQLVSDPLTEMERQRSRDSFPELVKDEDLVGIEDNRRLLTEWLYTDELDSKVITVSGMGGLGKTTLVTNVYEREKINFSAHAWMVVSQTYTVDALLRKLLWKVGYTEPPLSSNIDKMDVYDLKEEIKRMLKVRKCLIVLDDVWDQEAYFQIRDAFQNDQGSRVIITTRKNHVAALASSTCHLDLQPLSDIHGFDLFCRRAFYNIKDHECPTELVKVAKSIVERCQGLPLAIVSIGCLLSSRSRSHYVWNQAYNQLRSELSKNNHVRAILNMSYHDLSGDLRNCFLYCSLFPEDYPLSRESLVRLWIAEGFVLRKENNTPEAVAEGNLMELIYRNMLQVTEYDDLGRVNTCGMHDIMRDLALSAAKEEKFGSANDFGTMVEIDKDVRRLSTYRWKDSTAPILKLLRLRTIVSLEAFSSSIDMLSSVLSHSSYLTVLELQDSEITQVPPSIGNLFNLRYIGLRRTKVKSLPDSIEKLLNLHTLDMKQTKIEKLPRGITKIKKLRHLFADRCVDEKQSEFRYFVGMQAPKDLSNLKELQTLETVEASKDLAEQLKKLIQLKSVWIDNISSADCDNIFATLSNMPLLSSLLLSARNENEPLSFEALKPSSTELHRLIVRGQWAKSTLDYPIFRSHSTHLKYLSLSWCHLGEDPLGMLASNLSDLTYLKLNNMQSAATLVLRAKAFPKLKTLVLRQMPDVKQIKIMDGALPCIECLYIVLLPKLDKVPQGIESLNSLKKLSLLNLHKDFKIQWNVSPEDREELLLLSISIRIPLTDWVLHIDRTAPALQPCSLVFQQVMLLNLLV

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF197
10-939 PTHR23155:SF197,OS11G0227100 PROTEIN

TKIGDALANEIAKELIAKLSEKVNNLKDLDEKIEQMRKQLTTMNNVILQIGTTYLTDEVVKGWIGEVRKVAYRVEDVMDKYSYYSVQMAEEWFLKKYFIKASHYVIVFTEIANEVVKIEKEIKQVIELKDQWLHPSQLVSDPLTEMERQRSRDSFPELVKDEDLVGIEDNRRLLTEWLYTDELDSKVITVSGMGGLGKTTLVTNVYEREKINFSAHAWMVVSQTYTVDALLRKLLWKVGYTEPPLSSNIDKMDVYDLKEEIKRMLKVRKCLIVLDDVWDQEAYFQIRDAFQNDQGSRVIITTRKNHVAALASSTCHLDLQPLSDIHGFDLFCRRAFYNIKDHECPTELVKVAKSIVERCQGLPLAIVSIGCLLSSRSRSHYVWNQAYNQLRSELSKNNHVRAILNMSYHDLSGDLRNCFLYCSLFPEDYPLSRESLVRLWIAEGFVLRKENNTPEAVAEGNLMELIYRNMLQVTEYDDLGRVNTCGMHDIMRDLALSAAKEEKFGSANDFGTMVEIDKDVRRLSTYRWKDSTAPILKLLRLRTIVSLEAFSSSIDMLSSVLSHSSYLTVLELQDSEITQVPPSIGNLFNLRYIGLRRTKVKSLPDSIEKLLNLHTLDMKQTKIEKLPRGITKIKKLRHLFADRCVDEKQSEFRYFVGMQAPKDLSNLKELQTLETVEASKDLAEQLKKLIQLKSVWIDNISSADCDNIFATLSNMPLLSSLLLSARNENEPLSFEALKPSSTELHRLIVRGQWAKSTLDYPIFRSHSTHLKYLSLSWCHLGEDPLGMLASNLSDLTYLKLNNMQSAATLVLRAKAFPKLKTLVLRQMPDVKQIKIMDGALPCIECLYIVLLPKLDKVPQGIESLNSLKKLSLLNLHKDFKIQWNVSPEDREELLLLSISIRIPLTDWVLHIDRTAPALQPCSLVFQQVML

HMMPanther: PTHR23155
10-939 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

TKIGDALANEIAKELIAKLSEKVNNLKDLDEKIEQMRKQLTTMNNVILQIGTTYLTDEVVKGWIGEVRKVAYRVEDVMDKYSYYSVQMAEEWFLKKYFIKASHYVIVFTEIANEVVKIEKEIKQVIELKDQWLHPSQLVSDPLTEMERQRSRDSFPELVKDEDLVGIEDNRRLLTEWLYTDELDSKVITVSGMGGLGKTTLVTNVYEREKINFSAHAWMVVSQTYTVDALLRKLLWKVGYTEPPLSSNIDKMDVYDLKEEIKRMLKVRKCLIVLDDVWDQEAYFQIRDAFQNDQGSRVIITTRKNHVAALASSTCHLDLQPLSDIHGFDLFCRRAFYNIKDHECPTELVKVAKSIVERCQGLPLAIVSIGCLLSSRSRSHYVWNQAYNQLRSELSKNNHVRAILNMSYHDLSGDLRNCFLYCSLFPEDYPLSRESLVRLWIAEGFVLRKENNTPEAVAEGNLMELIYRNMLQVTEYDDLGRVNTCGMHDIMRDLALSAAKEEKFGSANDFGTMVEIDKDVRRLSTYRWKDSTAPILKLLRLRTIVSLEAFSSSIDMLSSVLSHSSYLTVLELQDSEITQVPPSIGNLFNLRYIGLRRTKVKSLPDSIEKLLNLHTLDMKQTKIEKLPRGITKIKKLRHLFADRCVDEKQSEFRYFVGMQAPKDLSNLKELQTLETVEASKDLAEQLKKLIQLKSVWIDNISSADCDNIFATLSNMPLLSSLLLSARNENEPLSFEALKPSSTELHRLIVRGQWAKSTLDYPIFRSHSTHLKYLSLSWCHLGEDPLGMLASNLSDLTYLKLNNMQSAATLVLRAKAFPKLKTLVLRQMPDVKQIKIMDGALPCIECLYIVLLPKLDKVPQGIESLNSLKKLSLLNLHKDFKIQWNVSPEDREELLLLSISIRIPLTDWVLHIDRTAPALQPCSLVFQQVML

superfamily: SSF52540
156-406 SSF52540

ERQRSRDSFPELVKDEDLVGIEDNRRLLTEWLYTDELDSKVITVSGMGGLGKTTLVTNVYEREKINFSAHAWMVVSQTYTVDALLRKLLWKVGYTEPPLSSNIDKMDVYDLKEEIKRMLKVRKCLIVLDDVWDQEAYFQIRDAFQNDQGSRVIITTRKNHVAALASSTCHLDLQPLSDIHGFDLFCRRAFYNIKDHECPTELVKVAKSIVERCQGLPLAIVSIGCLLSSRSRSHYVWNQAYNQLRSELSKN

Gene3D: G3DSA:3.40.50.300
180-312 G3DSA:3.40.50.300

RRLLTEWLYTDELDSKVITVSGMGGLGKTTLVTNVYEREKINFSAHAWMVVSQTYTVDALLRKLLWKVGYTEPPLSSNIDKMDVYDLKEEIKRMLKVRKCLIVLDDVWDQEAYFQIRDAFQNDQGSRVIITTR

HMMPfam: PF00931
IPR002182
181-456 NB-ARC,NBS
NB-ARC

RLLTEWLYTDELDSKVITVSGMGGLGKTTLVTNVYEREKINFSAHAWMVVSQTYTVDALLRKLLWKVGYTEPPLSSNIDKMDVYDLKEEIKRMLKVRKCLIVLDDVWDQEAYFQIRDAFQNDQGSRVIITTRKNHVAALASSTCHLDLQPLSDIHGFDLFCRRAFYNIKDHECPTELVKVAKSIVERCQGLPLAIVSIGCLLSSRSRSHYVWNQAYNQLRSELSKNNHVRAILNMSYHDLSGDLRNCFLYCSLFPEDYPLSRESLVRLWIAEGFVL

FPrintScan: PR00364
IPR000767
196-211 DISEASERSIST
Disease resistance protein

VITVSGMGGLGKTTLV

FPrintScan: PR00364
IPR000767
273-287 DISEASERSIST
Disease resistance protein

MLKVRKCLIVLDDVW

FPrintScan: PR00364
IPR000767
368-382 DISEASERSIST
Disease resistance protein

CQGLPLAIVSIGCLL

superfamily: SSF52058
495-931 SSF52058,LRR

GMHDIMRDLALSAAKEEKFGSANDFGTMVEIDKDVRRLSTYRWKDSTAPILKLLRLRTIVSLEAFSSSIDMLSSVLSHSSYLTVLELQDSEITQVPPSIGNLFNLRYIGLRRTKVKSLPDSIEKLLNLHTLDMKQTKIEKLPRGITKIKKLRHLFADRCVDEKQSEFRYFVGMQAPKDLSNLKELQTLETVEASKDLAEQLKKLIQLKSVWIDNISSADCDNIFATLSNMPLLSSLLLSARNENEPLSFEALKPSSTELHRLIVRGQWAKSTLDYPIFRSHSTHLKYLSLSWCHLGEDPLGMLASNLSDLTYLKLNNMQSAATLVLRAKAFPKLKTLVLRQMPDVKQIKIMDGALPCIECLYIVLLPKLDKVPQGIESLNSLKKLSLLNLHKDFKIQWNVSPEDREELLLLSISIRIPLTDWVLHIDRTAPALQPCS

Gene3D: G3DSA:3.80.10.10
549-677 G3DSA:3.80.10.10

RLRTIVSLEAFSSSIDMLSSVLSHSSYLTVLELQDSEITQVPPSIGNLFNLRYIGLRRTKVKSLPDSIEKLLNLHTLDMKQTKIEKLPRGITKIKKLRHLFADRCVDEKQSEFRYFVGMQAPKDLSNLK

Gene3D: G3DSA:3.80.10.10
678-882 G3DSA:3.80.10.10

ELQTLETVEASKDLAEQLKKLIQLKSVWIDNISSADCDNIFATLSNMPLLSSLLLSARNENEPLSFEALKPSSTELHRLIVRGQWAKSTLDYPIFRSHSTHLKYLSLSWCHLGEDPLGMLASNLSDLTYLKLNNMQSAATLVLRAKAFPKLKTLVLRQMPDVKQIKIMDGALPCIECLYIVLLPKLDKVPQGIESLNSLKKLSLL

FPrintScan: PR00364
IPR000767
799-815 DISEASERSIST
Disease resistance protein

SNLSDLTYLKLNNMQSA


List of References


The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
BMC Biol.: 2005, 3();20
PubMed:16188032 WorldCat.org DOI (I e)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox