PRGDB00048634 (NBS-LRR disease resistance protein, putative)

From PRG Wiki
Jump to: navigation, search
NBS-LRR disease resistance protein, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 108863896 (DP000010)
Gene Class NL
Domain Type NBS, LRR
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) chromosome 11, complete sequence.

DNA Sequence

ATGAAACCTCTTGGTAAGGATGATTCAAGAAACTTATTTTTCAGTACAGTTTTTGGCTCTCGTTCTAGCTGTCCTGAAAAACTTAGTGAGGTTTCACATGACATTGTAAGGAAATGTGGTGGTTTGCCCCTAGCTGTTGTCACTATCGCAAGTCTTTTATCAAGTCAGCTTGAGAAACAAGAGCGATGGAATTATATAAACAAGTCCTTAGGTTACAGTTTGATGACAAACCCTAATTTGGAAGGGATGAAACAACTACTGAATTTCTGTTACAACAATCTTCCTCAGCATTTGAAGGCGTGCATATTGTGTCTTAGTATGTATCAAGAGGGTAACATAATTTGGAAGGATGATTTGGTGAATCAATGGATAGCTGAAGGTTTTATATTTGCAATTGAAGGGCATGTCAAGGAAGAAATTTCAAGAGTCTATTTTGATGAGCTTGTTGGTAGAAACATTATCCAGCCTGTACATATCAATAACAATGGTGAGGTTTTGTCTTGTGTAGTTCACCATATGGTACTCAATTTTATTACATGCAAGTCGATGGAAGAAAATTTTATGGTTGCTATAGACCATTCACAGGCAGCTACAAGATGTGCTGACAAGGTTCGACGATTATCAATGCACTTCGGTAACATAGAAGATGCAACTCCACCAACTAATATAAGATTGTCCCAAGTTCGGACACTTGCCTTTTGGGGGGTCTTGAAGTGCATGTCTTTTATTACGGGGTTTCAACTTCTTAAAGTTCTAACTCTACATTTTTGGGGAGATGAGGATAGCATCAGCAGTTTTGATCTCACAAGAATTTCTGAACTTGTCCAACTGAGATATTTGAAGGTCACCTCTAATGTCACCTTAAAACTGCCAACCAAGATGCAAGGTCTACAATATTTGGAGACACTGAAAGTTGATGGAAATATAGATGGAGTTCCATCAGACATCATCCATTTGCCAGGCTTGCTGCATCTTAGTCTTCCTGCTAAGACAAACCTGCCCAGTGGAATCGTCCACATGACATCGCTTCGAACACTTGGATATTTTGATCTCAGCTGTAACTCAGCAGAGAATCTACTGAGCCTGGCTGAGCTGACCAATCTCCGGGATGTACAGCTCACCTATTCTGCTGCACATTCTGATGATCTGAAGAATAATATGCAATGCCTTGGATCCATTTTGGAGAAACTCAGCAACCTCAAGTCTATAACTCTGGCACAACCAGGCTCCTCTTATGCAAATACTCTGCACGTTGATAGTGCTACAAACATGAGGATATCTGTTGCTGGCTGGAGCATCCTGTCCTCTCCACCGGCCCTTCTTCAGAGGATTGAGTTGTTACCGTGTGTTTGCGTTTTTTCTAGTATCCCGAATTGGATTGGGAAGCATGGAAATCTCCGCATTTTAAAGATTGGGATTAGAGAAATAACAAGTAATGATGTTGATGTTCTCGGAGGATTACCCGCACTCACTGTTTTGTCACTGTATGTCCATACAAAACCTATAGAAATGATTATCTTTGACAAGGAAGGATTCTCAATCCTGAAATACTTCAAGTTTAGATGCAGCGTAGCGTGGATGAAATTTGAGGCCGGTGCAATGCCTAATCTTCAGAAGCTCAGGCTAGGTTTTGATGTTCATCGAGCAGATCAACACGATACTATTCCAGTCAGAATCGAACATCTGTCTGGAGTTGAAGAGATCTATGCAAAAATAAGGGTCACCTCTACTGCTGATGATCTTTGTAGAAGATTTGCAGAGTCAGCATTGACTAACGCCGTTACGATGCATCAAGGAAGTCCTAGTGTCAATATATGGTGTGTAGATTGGATCTTCGATGGTAAGGATGATAACATTGCCAAGAAACGAGAGGTAGAACATAGGATTTTGCAACAACAACCACATATTGTGAAAGAAGGCTCAAATGAGAAATCCGCATTTCTACAAAAGAACCTCGGGGAGGGAGCACATAAATCTGTTGGCAGCAGAGACAATTCACCATAA


Protein sequences

Name Description Sequence
NBS-LRR disease resistance protein, putative NBS-LRR disease resistance protein, putative [Oryza sativa (japonica cultivar-group)].

MKPLGKDDSRNLFFSTVFGSRSSCPEKLSEVSHDIVRKCGGLPLAVVTIASLLSSQLEKQERWNYINKSLGYSLMTNPNLEGMKQLLNFCYNNLPQHLKACILCLSMYQEGNIIWKDDLVNQWIAEGFIFAIEGHVKEEISRVYFDELVGRNIIQPVHINNNGEVLSCVVHHMVLNFITCKSMEENFMVAIDHSQAATRCADKVRRLSMHFGNIEDATPPTNIRLSQVRTLAFWGVLKCMSFITGFQLLKVLTLHFWGDEDSISSFDLTRISELVQLRYLKVTSNVTLKLPTKMQGLQYLETLKVDGNIDGVPSDIIHLPGLLHLSLPAKTNLPSGIVHMTSLRTLGYFDLSCNSAENLLSLAELTNLRDVQLTYSAAHSDDLKNNMQCLGSILEKLSNLKSITLAQPGSSYANTLHVDSATNMRISVAGWSILSSPPALLQRIELLPCVCVFSSIPNWIGKHGNLRILKIGIREITSNDVDVLGGLPALTVLSLYVHTKPIEMIIFDKEGFSILKYFKFRCSVAWMKFEAGAMPNLQKLRLGFDVHRADQHDTIPVRIEHLSGVEEIYAKIRVTSTADDLCRRFAESALTNAVTMHQGSPSVNIWCVDWIFDGKDDNIAKKREVEHRILQQQPHIVKEGSNEKSAFLQKNLGEGAHKSVGSRDNSP


Domains

Domain Start-End Description Sequence

superfamily: SSF52540
1-77 SSF52540

MKPLGKDDSRNLFFSTVFGSRSSCPEKLSEVSHDIVRKCGGLPLAVVTIASLLSSQLEKQERWNYINKSLGYSLMTN

HMMPfam: PF00931
IPR002182
3-130 NB-ARC,NBS
NB-ARC

PLGKDDSRNLFFSTVFGSRSSCPEKLSEVSHDIVRKCGGLPLAVVTIASLLSSQLEKQERWNYINKSLGYSLMTNPNLEGMKQLLNFCYNNLPQHLKACILCLSMYQEGNIIWKDDLVNQWIAEGFIF

HMMPanther: PTHR23155:SF196
79-542 PTHR23155:SF196,OS11G0225300 PROTEIN

NLEGMKQLLNFCYNNLPQHLKACILCLSMYQEGNIIWKDDLVNQWIAEGFIFAIEGHVKEEISRVYFDELVGRNIIQPVHINNNGEVLSCVVHHMVLNFITCKSMEENFMVAIDHSQAATRCADKVRRLSMHFGNIEDATPPTNIRLSQVRTLAFWGVLKCMSFITGFQLLKVLTLHFWGDEDSISSFDLTRISELVQLRYLKVTSNVTLKLPTKMQGLQYLETLKVDGNIDGVPSDIIHLPGLLHLSLPAKTNLPSGIVHMTSLRTLGYFDLSCNSAENLLSLAELTNLRDVQLTYSAAHSDDLKNNMQCLGSILEKLSNLKSITLAQPGSSYANTLHVDSATNMRISVAGWSILSSPPALLQRIELLPCVCVFSSIPNWIGKHGNLRILKIGIREITSNDVDVLGGLPALTVLSLYVHTKPIEMIIFDKEGFSILKYFKFRCSVAWMKFEAGAMPNLQKLRL

HMMPanther: PTHR23155
79-542 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

NLEGMKQLLNFCYNNLPQHLKACILCLSMYQEGNIIWKDDLVNQWIAEGFIFAIEGHVKEEISRVYFDELVGRNIIQPVHINNNGEVLSCVVHHMVLNFITCKSMEENFMVAIDHSQAATRCADKVRRLSMHFGNIEDATPPTNIRLSQVRTLAFWGVLKCMSFITGFQLLKVLTLHFWGDEDSISSFDLTRISELVQLRYLKVTSNVTLKLPTKMQGLQYLETLKVDGNIDGVPSDIIHLPGLLHLSLPAKTNLPSGIVHMTSLRTLGYFDLSCNSAENLLSLAELTNLRDVQLTYSAAHSDDLKNNMQCLGSILEKLSNLKSITLAQPGSSYANTLHVDSATNMRISVAGWSILSSPPALLQRIELLPCVCVFSSIPNWIGKHGNLRILKIGIREITSNDVDVLGGLPALTVLSLYVHTKPIEMIIFDKEGFSILKYFKFRCSVAWMKFEAGAMPNLQKLRL

Gene3D: G3DSA:3.80.10.10
202-391 G3DSA:3.80.10.10

DKVRRLSMHFGNIEDATPPTNIRLSQVRTLAFWGVLKCMSFITGFQLLKVLTLHFWGDEDSISSFDLTRISELVQLRYLKVTSNVTLKLPTKMQGLQYLETLKVDGNIDGVPSDIIHLPGLLHLSLPAKTNLPSGIVHMTSLRTLGYFDLSCNSAENLLSLAELTNLRDVQLTYSAAHSDDLKNNMQCLG

superfamily: SSF52047
202-574 SSF52047,LRR

DKVRRLSMHFGNIEDATPPTNIRLSQVRTLAFWGVLKCMSFITGFQLLKVLTLHFWGDEDSISSFDLTRISELVQLRYLKVTSNVTLKLPTKMQGLQYLETLKVDGNIDGVPSDIIHLPGLLHLSLPAKTNLPSGIVHMTSLRTLGYFDLSCNSAENLLSLAELTNLRDVQLTYSAAHSDDLKNNMQCLGSILEKLSNLKSITLAQPGSSYANTLHVDSATNMRISVAGWSILSSPPALLQRIELLPCVCVFSSIPNWIGKHGNLRILKIGIREITSNDVDVLGGLPALTVLSLYVHTKPIEMIIFDKEGFSILKYFKFRCSVAWMKFEAGAMPNLQKLRLGFDVHRADQHDTIPVRIEHLSGVEEIYAKIRV

Gene3D: G3DSA:3.80.10.10
457-495 G3DSA:3.80.10.10

PNWIGKHGNLRILKIGIREITSNDVDVLGGLPALTVLSL


List of References


The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
BMC Biol.: 2005, 3();20
PubMed:16188032 WorldCat.org DOI (I e)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox