PRGDB00048637 (disease resistance protein RPM1, putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein RPM1, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 108863896 (DP000010)
Gene Class Unknown
Domain Type LRR
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa (japonica cultivar-group) chromosome 11, complete sequence.

DNA Sequence

CTGTTGATATTGTCCTTCCTGTCAAGAAACCGAGGCAATTCATGGCGGGTGCACTGGTGAGCGCCTCTACAGGAGTCATGGAGTCTCTCCTCGGCAAGCTATCCAGTATGCTGGAAAAAGAGTATGCCAAGAAGAAAACAGTAGAGAAGGATGTGCTGTTCCTGCGAAACGAGCTGAGCAGCATGAACACCGTGATGCAGAAGTACGCGATGTTGAGTGAGCCCCACTTGCAAGTGAAGGCTTGGATGAAAGAGGTAAGGGAGCTGGCCTACGACATCGAGGACACCATTGACGCTTTCATGGCTCGGAGTGAAAAATCCAATGAGCCTACAGGTATCAGAGGATTTATCATCAACAATATCCTGAAACTGAGAGAGCTGCTCTCAAGCTGTACTATTTCTCAAGAGATTGAAAAACTCAAGAACCAAGTTCTCGAGGTGAACGATCGTAGAAAAAGGTATAAGCTTGATGTATCTGTGTCCATGGGTACCGGCTGTGAATCCATTGACCCTCGCCTGCCAGCGTTTTATTCCGGAGAGACGCTCCGGTGCCCTCTACTTGCAGTATTCTACTCCAAGTAGATGAACATCGGAGATTTGTTCATATCACCAGTAAAATTTTTACTCATGGGTGTATTTGCAA


Protein sequences

Name Description Sequence
disease resistance protein RPM1, putative disease resistance protein RPM1, putative [Oryza sativa (japonica cultivar-group)].

MNIGDLFISPVKFLLMGVFATVDIVLPVKKPRQFMAGALVSASTGVMESLLGKLSSMLEKEYAKKKTVEKDVLFLRNELSSMNTVMQKYAMLSEPHLQVKAWMKEVRELAYDIEDTIDAFMARSEKSNEPTGIRGFIINNILKLRELLSSCTISQEIEKLKNQVLEVNDRRKRYKLDVSVSMGTGCESIDPRLPAFYSGETLRCPLLAVFYSK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF201
43-198 PTHR23155:SF201,OS11G0265900 PROTEIN

STGVMESLLGKLSSMLEKEYAKKKTVEKDVLFLRNELSSMNTVMQKYAMLSEPHLQVKAWMKEVRELAYDIEDTIDAFMARSEKSNEPTGIRGFIINNILKLRELLSSCTISQEIEKLKNQVLEVNDRRKRYKLDVSVSMGTGCESIDPRLPAFYS

HMMPanther: PTHR23155
43-198 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

STGVMESLLGKLSSMLEKEYAKKKTVEKDVLFLRNELSSMNTVMQKYAMLSEPHLQVKAWMKEVRELAYDIEDTIDAFMARSEKSNEPTGIRGFIINNILKLRELLSSCTISQEIEKLKNQVLEVNDRRKRYKLDVSVSMGTGCESIDPRLPAFYS


List of References


The sequence of rice chromosomes 11 and 12, rich in disease resistance genes and recent gene duplications.
BMC Biol.: 2005, 3();20
PubMed:16188032 WorldCat.org DOI (I e)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox