PRGDB00048927 (putative NBS-LRR disease resistance protein)

From PRG Wiki
Jump to: navigation, search
putative NBS-LRR disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 108946794 (DQ644141)
Gene Class NL
Domain Type NBS, LRR
Gene Species Malus x domestica

Comment?

Malus x domestica clone ABFA999100CT putative NBS-LRR disease resistance protein gene, partial cds.

DNA Sequence

CCTTGCTAAGCTTGTTTATGATAGAATCTTTCATCATTTTGAAGTTCACTGCTTTCTCGGCAACGTTAGAGAGGTTTCTAACGTTGATCTTCAAAAAAGACTTCTTTTCCCGGTGTTGAGGGAAAAGATTGAAGAAATTTGGGACGAAGAGCGTAGAATTATTTTCACTAAGAAGTTCTTACGCAACAAAAAGGTTCTTCGTGTACTTGATGATGTGGATCACATAAACCAGCTACAAGTACTAGCTGGAAAGGAAGATTGGTTTGGCATGGGAAGTCGAATTATCATTACAACTAGAAATGAACGTCTGCTAGTCCAGCATGACGTAACATTATGTCATCATGTCAAAATGTTGGATAAAGGCGCAGCTCTTGAACTGTTTAGCCTACATGCCTTTAAGAAAAATATGCCTGAAGATGGGTTTTGGGAACTGTCAACGTATTTCATTAATTATGCTGGA


Protein sequences

Name Description Sequence
putative NBS-LRR disease resistance protein putative NBS-LRR disease resistance protein [Malus x domestica].

LAKLVYDRIFHHFEVHCFLGNVREVSNVDLQKRLLFPVLREKIEEIWDEERRIIFTKKFLRNKKVLRVLDDVDHINQLQVLAGKEDWFGMGSRIIITTRNERLLVQHDVTLCHHVKMLDKGAALELFSLHAFKKNMPEDGFWELSTYFINYAG


Domains

Domain Start-End Description Sequence

superfamily: SSF52540
1-137 SSF52540

LAKLVYDRIFHHFEVHCFLGNVREVSNVDLQKRLLFPVLREKIEEIWDEERRIIFTKKFLRNKKVLRVLDDVDHINQLQVLAGKEDWFGMGSRIIITTRNERLLVQHDVTLCHHVKMLDKGAALELFSLHAFKKNMP

HMMPanther: PTHR11017:SF20
1-153 PTHR11017:SF20,SUBFAMILY NOT NAMED

LAKLVYDRIFHHFEVHCFLGNVREVSNVDLQKRLLFPVLREKIEEIWDEERRIIFTKKFLRNKKVLRVLDDVDHINQLQVLAGKEDWFGMGSRIIITTRNERLLVQHDVTLCHHVKMLDKGAALELFSLHAFKKNMPEDGFWELSTYFINYAG

HMMPanther: PTHR11017
1-153 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

LAKLVYDRIFHHFEVHCFLGNVREVSNVDLQKRLLFPVLREKIEEIWDEERRIIFTKKFLRNKKVLRVLDDVDHINQLQVLAGKEDWFGMGSRIIITTRNERLLVQHDVTLCHHVKMLDKGAALELFSLHAFKKNMPEDGFWELSTYFINYAG

HMMPfam: PF00931
IPR002182
7-136 NB-ARC,NBS
NB-ARC

DRIFHHFEVHCFLGNVREVSNVDLQKRLLFPVLREKIEEIWDEERRIIFTKKFLRNKKVLRVLDDVDHINQLQVLAGKEDWFGMGSRIIITTRNERLLVQHDVTLCHHVKMLDKGAALELFSLHAFKKNM






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox