PRGDB00048929 (At2g32830)

From PRG Wiki
Jump to: navigation, search
At2g32830
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 20196988 (AC003033)
Gene Class Unknown
Domain Type LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana chromosome 2 BAC T21L14 genomic sequence, complete sequence.

DNA Sequence

ATGAAGACCGTGTTTAAATCGCTTCTGCTTTTGCATTTTCTCTTGCTACTCTTACTCTGTTTTGTCTCCCCTTCGAGCTTTTTCCTTCTAAAAGTTCCGGTTGGTGGTCTTGTTGCTTGTCGTCTCCGCCAGAGTCAAGCCTTTATGCAGTTCAAGGACGAGTTTGATACCCGCCATTGCAACCACAGTGACGACTTCAATGGAGTCTGGTGCGATAACTCCACGGGTGCGGTCACAGTGCTACAACTCAGGGACTGTCTCAGTGGAACTCTGAAGTCAAACAGTAGCCTCTTCGGGTTTCATCAGCTCCGTTATCTTGCTCTCAATCGAAACAACTTCACCTCTGCTTCGCTCCCTTCAGAGTTCTGCAATCTCAACAAATTAAAGCTCTTGTCTCTTTTCTCTAATGGCTTTATAGATCTTTCCCATAATGATCTCATGGGTAGTTTCCCGCTGGTGCGAAATCTAGGCAAGCTCGCAGTTTTAGACCTTTCGGATAATCACTTCTCTGGAACTCTGAATCCCAACAATAGCCTCTTTGAGTTGCACTCCCTCCGTTACCTGAATCTGGCTTTCAATAACATTAGTTCCTCACTTCCTTCCAAATTTGGCAATCTCAACAAATTAGAGGTCTTATCTCTTTCTTTTAATGGCTTTTCTGGTCAATGTTTTCCCACAATTAGTAACCTTACCCGGATAACGCAGCTGTACCTCCACAATAATGAGCTCACCGGTAGTTTCCCACTTGTACAAAACCTAACTAAGCTCTCTTTTCTAGGACTTTCGGATAATCTCTTTTCTGGAACCATTCCTTCTTACCTCTTCACTTTCCCTTCCTTATCAACTCTTGATCTGCGTGAAAATGATCTCTCCGGTTCTATTGAAGTTCCTAACTCATCTACCTCATCTAAGCTCGAGATCATGTACCTTGGGTTTAACCATCTTGAAGGAAAAATCCTAGAGCCGATCTCAAAGCTTATCAACCTCAAGCGTCTCGACCTTTCTTTCCTAAATACAAGCTACCCAATTGACTTAAACCTCTTGTCTCCTCTCAAATCTTTGTCTTACCTTGATTTTTCGGGTAATAGTTTATCTCCAGCCAGTTTAAGTTCAAGTTCGTACATCCCGCTGAGCATGGAAAGCATAGTCTTGTCGCTCTGCGGCATCCGCGAGTTCCCAAACATCTTAAAACATCTTCAAAACTTGATTCATATAGACATAACCAGTAATCAAATTAAAGGAAAAATACCTGAGTGGTTATGGACCCTTCCTCAGCTAAGCTTCGTGGATATTTCCAATAATTCGTTCAACGGTTTCCAAGGTTCGGCAGAAGTTTTTGTAAACTTATCAGTGCGGATTTTAATGTTGGATGCAAACAATTTTGAAGGAGCACTTCCTACTCTACCACTCTCTATCATCGGCTTCTCTGCGATTCATAATAGTTTCACAGGAGAGATACCTCTTTCAATCTGCAACCGAACATCTCTTACAATGGTTGATCTATCCTACAACAACTTCACCGGTCCAATTCCTCAATGTCTTAGTAACTTCATGTTTGTCAATCTCCGGAAGAACGACCTGGAAGGAAGTATCCCTGACACTTTCTATACTGATTCTTCTCTAAAATCACTTGACGTTGGCTACAATCGACTAACCGGAAAGCTTCCAAGGTCTCTTCTAAATTGCTCCTCTCTGAGATTTCTAAGCGTTGACAACAACAGAGTCAAAGACACATTTCCTTTCTGGCTCAAGGCTTTACCAAATTTGCGTGTCCTTACCCTTCGTTCAAACAAATTCTACGGTCCTATATCTCCTCCTCATCAAGGTCCTCTCGGGTTTCCAGAGTTGCGGATATTTGAGATAGCTGATAATATGTTTACTGGAAGCTTGCCACCAAGTTTCTTTGTGAATTGGAAAGCATCAGCCCTCACGAAGAATGAAGATGGCGGATTATATATGGTGTATGAATACGATAAGGCTGCTAACAGTCCAGTTCGCTACACTTATACAGATACCATAGATTTGCAATACAAAGGTCTACACATGGAGCAAGAGAGGGTCCTTACTTCTTATGCCGCCATTGATTTTTCTGGAAACAGACTACAAGGACAGATTCCTGAATCCATTGGTCTCTTGAAGGCATTGATTGCGCTCAACTTATCGAACAACGCATTCACAGGCCATATTCCTCTGTCTTTCGCCAATCTTATGAATCTCGAGTCACTAGACATGTCAGGAAACCAACTCTCTGGGACTATTCCTAATGGACTTGGGAGCCTCTCGTTTTTGGTGTACATAAGTGTGGCTCATAACAAACTCAAAGGTGAAATACCACAAGGAACACAAATTACCGGGCAAATTAAATCATCTTTCGAAGGGAATGCAGGGCTTTGTGGTCTTCCTCTCCAGGAAACTTGCTTTGACTCTAGTGTGCCACCGATACAACCAAAGCAAGAAGACGAAGAAAAAGGAGAGGTGATTAACTGGAAAGCAGTAGCTATAGGATATGCTCCTGGATTGTTGTTTGGATTGGCAATAGCACATCTCATTGCTTCATACAAGCCAGAGTGGCTCGTCAAAATTATTGGCTTCTGA


Protein sequences

Name Description Sequence
putative leucine-rich repeat disease resistance protein putative leucine-rich repeat disease resistance protein [Arabidopsis thaliana].

MKTVFKSLLLLHFLLLLLLCFVSPSSFFLLKVPVGGLVACRLRQSQAFMQFKDEFDTRHCNHSDDFNGVWCDNSTGAVTVLQLRDCLSGTLKSNSSLFGFHQLRYLALNRNNFTSASLPSEFCNLNKLKLLSLFSNGFIDLSHNDLMGSFPLVRNLGKLAVLDLSDNHFSGTLNPNNSLFELHSLRYLNLAFNNISSSLPSKFGNLNKLEVLSLSFNGFSGQCFPTISNLTRITQLYLHNNELTGSFPLVQNLTKLSFLGLSDNLFSGTIPSYLFTFPSLSTLDLRENDLSGSIEVPNSSTSSKLEIMYLGFNHLEGKILEPISKLINLKRLDLSFLNTSYPIDLNLLSPLKSLSYLDFSGNSLSPASLSSSSYIPLSMESIVLSLCGIREFPNILKHLQNLIHIDITSNQIKGKIPEWLWTLPQLSFVDISNNSFNGFQGSAEVFVNLSVRILMLDANNFEGALPTLPLSIIGFSAIHNSFTGEIPLSICNRTSLTMVDLSYNNFTGPIPQCLSNFMFVNLRKNDLEGSIPDTFYTDSSLKSLDVGYNRLTGKLPRSLLNCSSLRFLSVDNNRVKDTFPFWLKALPNLRVLTLRSNKFYGPISPPHQGPLGFPELRIFEIADNMFTGSLPPSFFVNWKASALTKNEDGGLYMVYEYDKAANSPVRYTYTDTIDLQYKGLHMEQERVLTSYAAIDFSGNRLQGQIPESIGLLKALIALNLSNNAFTGHIPLSFANLMNLESLDMSGNQLSGTIPNGLGSLSFLVYISVAHNKLKGEIPQGTQITGQIKSSFEGNAGLCGLPLQETCFDSSVPPIQPKQEDEEKGEVINWKAVAIGYAPGLLFGLAIAHLIASYKPEWLVKIIGF


Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.80.10.10
64-142 G3DSA:3.80.10.10

DDFNGVWCDNSTGAVTVLQLRDCLSGTLKSNSSLFGFHQLRYLALNRNNFTSASLPSEFCNLNKLKLLSLFSNGFIDLS

HMMPanther: PTHR26393:SF503
78-863 PTHR26393:SF503

VTVLQLRDCLSGTLKSNSSLFGFHQLRYLALNRNNFTSASLPSEFCNLNKLKLLSLFSNGFIDLSHNDLMGSFPLVRNLGKLAVLDLSDNHFSGTLNPNNSLFELHSLRYLNLAFNNISSSLPSKFGNLNKLEVLSLSFNGFSGQCFPTISNLTRITQLYLHNNELTGSFPLVQNLTKLSFLGLSDNLFSGTIPSYLFTFPSLSTLDLRENDLSGSIEVPNSSTSSKLEIMYLGFNHLEGKILEPISKLINLKRLDLSFLNTSYPIDLNLLSPLKSLSYLDFSGNSLSPASLSSSSYIPLSMESIVLSLCGIREFPNILKHLQNLIHIDITSNQIKGKIPEWLWTLPQLSFVDISNNSFNGFQGSAEVFVNLSVRILMLDANNFEGALPTLPLSIIGFSAIHNSFTGEIPLSICNRTSLTMVDLSYNNFTGPIPQCLSNFMFVNLRKNDLEGSIPDTFYTDSSLKSLDVGYNRLTGKLPRSLLNCSSLRFLSVDNNRVKDTFPFWLKALPNLRVLTLRSNKFYGPISPPHQGPLGFPELRIFEIADNMFTGSLPPSFFVNWKASALTKNEDGGLYMVYEYDKAANSPVRYTYTDTIDLQYKGLHMEQERVLTSYAAIDFSGNRLQGQIPESIGLLKALIALNLSNNAFTGHIPLSFANLMNLESLDMSGNQLSGTIPNGLGSLSFLVYISVAHNKLKGEIPQGTQITGQIKSSFEGNAGLCGLPLQETCFDSSVPPIQPKQEDEEKGEVINWKAVAIGYAPGLLFGLAIAHLIASYKPEWLVKIIG

HMMPanther: PTHR26393
78-863 PTHR26393,FAMILY NOT NAMED

VTVLQLRDCLSGTLKSNSSLFGFHQLRYLALNRNNFTSASLPSEFCNLNKLKLLSLFSNGFIDLSHNDLMGSFPLVRNLGKLAVLDLSDNHFSGTLNPNNSLFELHSLRYLNLAFNNISSSLPSKFGNLNKLEVLSLSFNGFSGQCFPTISNLTRITQLYLHNNELTGSFPLVQNLTKLSFLGLSDNLFSGTIPSYLFTFPSLSTLDLRENDLSGSIEVPNSSTSSKLEIMYLGFNHLEGKILEPISKLINLKRLDLSFLNTSYPIDLNLLSPLKSLSYLDFSGNSLSPASLSSSSYIPLSMESIVLSLCGIREFPNILKHLQNLIHIDITSNQIKGKIPEWLWTLPQLSFVDISNNSFNGFQGSAEVFVNLSVRILMLDANNFEGALPTLPLSIIGFSAIHNSFTGEIPLSICNRTSLTMVDLSYNNFTGPIPQCLSNFMFVNLRKNDLEGSIPDTFYTDSSLKSLDVGYNRLTGKLPRSLLNCSSLRFLSVDNNRVKDTFPFWLKALPNLRVLTLRSNKFYGPISPPHQGPLGFPELRIFEIADNMFTGSLPPSFFVNWKASALTKNEDGGLYMVYEYDKAANSPVRYTYTDTIDLQYKGLHMEQERVLTSYAAIDFSGNRLQGQIPESIGLLKALIALNLSNNAFTGHIPLSFANLMNLESLDMSGNQLSGTIPNGLGSLSFLVYISVAHNKLKGEIPQGTQITGQIKSSFEGNAGLCGLPLQETCFDSSVPPIQPKQEDEEKGEVINWKAVAIGYAPGLLFGLAIAHLIASYKPEWLVKIIG

HMMPfam: PF00560
IPR001611
102-125 LRR_1
Leucine-rich repeat

QLRYLALNRNNFTSASLPSEFCNL

superfamily: SSF52047
106-437 SSF52047,LRR

LALNRNNFTSASLPSEFCNLNKLKLLSLFSNGFIDLSHNDLMGSFPLVRNLGKLAVLDLSDNHFSGTLNPNNSLFELHSLRYLNLAFNNISSSLPSKFGNLNKLEVLSLSFNGFSGQCFPTISNLTRITQLYLHNNELTGSFPLVQNLTKLSFLGLSDNLFSGTIPSYLFTFPSLSTLDLRENDLSGSIEVPNSSTSSKLEIMYLGFNHLEGKILEPISKLINLKRLDLSFLNTSYPIDLNLLSPLKSLSYLDFSGNSLSPASLSSSSYIPLSMESIVLSLCGIREFPNILKHLQNLIHIDITSNQIKGKIPEWLWTLPQLSFVDISNNSFN

Gene3D: G3DSA:3.80.10.10
143-356 G3DSA:3.80.10.10

HNDLMGSFPLVRNLGKLAVLDLSDNHFSGTLNPNNSLFELHSLRYLNLAFNNISSSLPSKFGNLNKLEVLSLSFNGFSGQCFPTISNLTRITQLYLHNNELTGSFPLVQNLTKLSFLGLSDNLFSGTIPSYLFTFPSLSTLDLRENDLSGSIEVPNSSTSSKLEIMYLGFNHLEGKILEPISKLINLKRLDLSFLNTSYPIDLNLLSPLKSLSY

HMMPfam: PF12799
184-221 LRR_4,Leucine Rich repeats (2 copies)

SLRYLNLAFNNISSSLPSKFGNLNKLEVLSLSFNGFSG

Gene3D: G3DSA:3.80.10.10
357-515 G3DSA:3.80.10.10

LDFSGNSLSPASLSSSSYIPLSMESIVLSLCGIREFPNILKHLQNLIHIDITSNQIKGKIPEWLWTLPQLSFVDISNNSFNGFQGSAEVFVNLSVRILMLDANNFEGALPTLPLSIIGFSAIHNSFTGEIPLSICNRTSLTMVDLSYNNFTGPIPQCLS

HMMPfam: PF13855
381-435 LRR_8,Leucine rich repeat

SIVLSLCGIREFPNILKHLQNLIHIDITSNQIKGKIPEWLWTLPQLSFVDISNNS

superfamily: SSF52058
445-806 SSF52058,LRR

VFVNLSVRILMLDANNFEGALPTLPLSIIGFSAIHNSFTGEIPLSICNRTSLTMVDLSYNNFTGPIPQCLSNFMFVNLRKNDLEGSIPDTFYTDSSLKSLDVGYNRLTGKLPRSLLNCSSLRFLSVDNNRVKDTFPFWLKALPNLRVLTLRSNKFYGPISPPHQGPLGFPELRIFEIADNMFTGSLPPSFFVNWKASALTKNEDGGLYMVYEYDKAANSPVRYTYTDTIDLQYKGLHMEQERVLTSYAAIDFSGNRLQGQIPESIGLLKALIALNLSNNAFTGHIPLSFANLMNLESLDMSGNQLSGTIPNGLGSLSFLVYISVAHNKLKGEIPQGTQITGQIKSSFEGNAGLCGLPLQETC

Gene3D: G3DSA:3.80.10.10
516-645 G3DSA:3.80.10.10

NFMFVNLRKNDLEGSIPDTFYTDSSLKSLDVGYNRLTGKLPRSLLNCSSLRFLSVDNNRVKDTFPFWLKALPNLRVLTLRSNKFYGPISPPHQGPLGFPELRIFEIADNMFTGSLPPSFFVNWKASALTK

HMMPfam: PF13855
539-598 LRR_8,Leucine rich repeat

SSLKSLDVGYNRLTGKLPRSLLNCSSLRFLSVDNNRVKDTFPFWLKALPNLRVLTLRSNK

Gene3D: G3DSA:3.80.10.10
694-804 G3DSA:3.80.10.10

IDFSGNRLQGQIPESIGLLKALIALNLSNNAFTGHIPLSFANLMNLESLDMSGNQLSGTIPNGLGSLSFLVYISVAHNKLKGEIPQGTQITGQIKSSFEGNAGLCGLPLQE

HMMPfam: PF13855
694-749 LRR_8,Leucine rich repeat

IDFSGNRLQGQIPESIGLLKALIALNLSNNAFTGHIPLSFANLMNLESLDMSGNQL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox