PRGDB00048930 (At2g32830)

From PRG Wiki
Jump to: navigation, search
At2g32830
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 20196988 (AC003033)
Gene Class Unknown
Domain Type LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana chromosome 2 BAC T21L14 genomic sequence, complete sequence.

DNA Sequence

ATGATATACACTAAGAATGCTTACGGTAGCATTTCTTATACCTATCAAGATTTTATAGATTTAAGATACAAAGGTCTACACATGGAGCAAAAGAGGATTCTTACTTTATACAGCGCTATTGATTTTTCCGGAAACAGACTTGAAGGACAGATTCCTGAATCCATTGGTCTCTTGAAGGCACTGATTGCACTCAACTTATCAAACAACGCTTTCATAGGTAATATTCCCATGTCTATGGCCAATCTTATTGAGCTTGAATCATTAGACATGTCTAGAAACGGACTATCTGGGACTATTCCTCAAGGACTCAAGACCCTCTCGTTTTTGGGGTACATAAATGTGTCCCATAACCAACTCAAGGGTGAAATACCACAAGGAACACAAATCACTGGGCCACCAAAATCCTCATTTGAAGGGAATGCAGGGCTTTGTGGTCTTCCTCTCGAAGAAAGTTGCTTCGGAACGAAAGTGCCACCAATACAACAGTCAAAGAAAGAAGACAACCAAGAGGATGCAAAAGTGTTGAACTGGAAAGCAGTGGCAACAGGGTATGGACCTGGAGTTTTTTTTGGATTGGCAATAGCGCAAATCATTGCTTCATACAAACCGGAGTGGCTCGTCAAGATAATTGGTCCTAATAAGCGTAGAAACCATTAA


Protein sequences

Name Description Sequence
similar to disease resistance protein (Cf-2.2) similar to disease resistance protein (Cf-2.2) [Arabidopsis thaliana].

MIYTKNAYGSISYTYQDFIDLRYKGLHMEQKRILTLYSAIDFSGNRLEGQIPESIGLLKALIALNLSNNAFIGNIPMSMANLIELESLDMSRNGLSGTIPQGLKTLSFLGYINVSHNQLKGEIPQGTQITGPPKSSFEGNAGLCGLPLEESCFGTKVPPIQQSKKEDNQEDAKVLNWKAVATGYGPGVFFGLAIAQIIASYKPEWLVKIIGPNKRRNH


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR26393:SF503
1-218 PTHR26393:SF503

MIYTKNAYGSISYTYQDFIDLRYKGLHMEQKRILTLYSAIDFSGNRLEGQIPESIGLLKALIALNLSNNAFIGNIPMSMANLIELESLDMSRNGLSGTIPQGLKTLSFLGYINVSHNQLKGEIPQGTQITGPPKSSFEGNAGLCGLPLEESCFGTKVPPIQQSKKEDNQEDAKVLNWKAVATGYGPGVFFGLAIAQIIASYKPEWLVKIIGPNKRRNH

HMMPanther: PTHR26393
1-218 PTHR26393,FAMILY NOT NAMED

MIYTKNAYGSISYTYQDFIDLRYKGLHMEQKRILTLYSAIDFSGNRLEGQIPESIGLLKALIALNLSNNAFIGNIPMSMANLIELESLDMSRNGLSGTIPQGLKTLSFLGYINVSHNQLKGEIPQGTQITGPPKSSFEGNAGLCGLPLEESCFGTKVPPIQQSKKEDNQEDAKVLNWKAVATGYGPGVFFGLAIAQIIASYKPEWLVKIIGPNKRRNH

Gene3D: G3DSA:3.80.10.10
39-149 G3DSA:3.80.10.10

AIDFSGNRLEGQIPESIGLLKALIALNLSNNAFIGNIPMSMANLIELESLDMSRNGLSGTIPQGLKTLSFLGYINVSHNQLKGEIPQGTQITGPPKSSFEGNAGLCGLPLE

superfamily: SSF52058
40-152 SSF52058,LRR

IDFSGNRLEGQIPESIGLLKALIALNLSNNAFIGNIPMSMANLIELESLDMSRNGLSGTIPQGLKTLSFLGYINVSHNQLKGEIPQGTQITGPPKSSFEGNAGLCGLPLEESC

HMMPfam: PF00560
IPR001611
61-82 LRR_1
Leucine-rich repeat

LIALNLSNNAFIGNIPMSMANL

HMMPfam: PF00560
IPR001611
85-106 LRR_1
Leucine-rich repeat

LESLDMSRNGLSGTIPQGLKTL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox