PRGDB00048931 (putative NBS-LRR disease resistance protein)

From PRG Wiki
Jump to: navigation, search
putative NBS-LRR disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 83571777 (DQ285630)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Oryza sativa Indica Group

Comment?

Oryza sativa (indica cultivar-group) putative nitrate-induced NOI protein (75-1-127BAC12.1), putative NBS-LRR disease resistance protein (Nbs1-Pi9), putative NBS-LRR disease resistance protein (Nbs3-Pi9), and NBS-LRR disease resistance protein (Pi9) genes

DNA Sequence

ATGGCGGATACAGTACTCAGCATTGCAAAGTCCCTGGTGGGAAGTGCTGTAAGTAAGGTTGCTTCGGTTGCTGCCGACAAGATGATCTTGCTGCTGGGAGTGCAGAAGGAGATATGTTGCATTAGATTTTTTGGGACCACACTTATGCAGAGTGAAATTAAAGTTACCCTCAGATTCGATGTAGATCGGTCTGACCGGAGTAGTCTCGTCAGGTCTGACCGCGCCTGTGCCGCCGGTCTGACCGCAGTCACCTGCCGGTCTGACCGCCGTGATGCCGCCGGTCTGACCGCCGGTGCGCCGCCGGTTAGACCGCCGAAACCCGGTGAAACACAAATCGAAGAACTCTTAAAGTTCATCAAAGACGAGCTACAAACGATACAAGCATTTTTGATGGCTGCCGAAGCATCAAAGAAAAGCATACTGTTGAAGGTTTGGGTGCAGCAAGTAAGGGATCTATCCTATGACATTGAAGATTGCCTTGATGAATTTACAGTTCATGTGGGCAGCCAAACCTTGTCGAGGCAGTTGATGAAGCTAAAGGATCGCCATCGGATCGCCGTTCAGATCCGCAATCTCAGGACAAGAATCGAAGAAGTGAGCAGTAGGAACACACGCTACAACTTAATAGAGAATGACCTTACCAGCACCACTGGTGAGAGGAATTTCATTATGGAAGACATTCGAAATGAATCAGCTAACAATATCGAGGAAGCTGAGCTTGTGGGTTTTTCGGGACCCAAAAGAGAGTTGCTTGATCTTATAGATGTCCATGCCAAGGATGGACCTACAAAGGTTGTATGTGTTGTCGGTATGGGTGGTTTGGGTAAGACTACTATTGCAAGGAAAATTTATGAAAGCAAAGAGGACATTGCAAAGAATTTTTCTTGCTGTGCTTGGATTACTGTTTCACAGTCCTTTGTTAGGTTGGAACTACTCAAGGATTTGATGGTGAAACTTTTTGGAGAGGAAGTACTCAAGAAGCGGCTGAGAGAACTTGAAGGGAAGGTTCCACAAGTAGACGACCTCGCCAGCTACCTCAGGACAGAGTTAAATGAAAGGAGGTACTTTGTTGTGCTTGATGATGTGTGGAGTACAGATTCATGGAAATGGATTAATAGTATTGCCTTCCCTAGAAATAACAATAAAGGGAGCCGGGTGATAGTAACAACAAGAGATGTTGGCTTAGCTAAGGAGTGTACTTCTGAATTGCTTATCTACCGGCTTAAACCCCTAGAAATAACCTATGCGAAAGAGTTGCTTCTAAGGAAAGCAAATAAAAAAATTGAAGATATGAAAAGTGATAAAAAGATGAGTGACATCATTACTAAAATAGTAAAAAAGTGTGGCTATTTACCACTGGCTATACTCACAATAGGAGGCGTGCTTGCCACCAAAGATCCATCAAGAGCGGGTGTACGAGGAGAATTTAAGAGCTGTCGAATCCACGACATCATGCGTGATATTGCAATTTCGATTTCTAGAGAGGAAAATTTCATACTCTTACCTGAGGGCACTGACTATGACGTAGTGCATGGGAACACTCGGCACATAGCATTTCACGGGA


Protein sequences

Name Description Sequence
putative NBS-LRR disease resistance protein putative NBS-LRR disease resistance protein [Oryza sativa (indica cultivar-group)].

MADTVLSIAKSLVGSAVSKVASVAADKMILLLGVQKEICCIRFFGTTLMQSEIKVTLRFDVDRSDRSSLVRSDRACAAGLTAVTCRSDRRDAAGLTAGAPPVRPPKPGETQIEELLKFIKDELQTIQAFLMAAEASKKSILLKVWVQQVRDLSYDIEDCLDEFTVHVGSQTLSRQLMKLKDRHRIAVQIRNLRTRIEEVSSRNTRYNLIENDLTSTTGERNFIMEDIRNESANNIEEAELVGFSGPKRELLDLIDVHAKDGPTKVVCVVGMGGLGKTTIARKIYESKEDIAKNFSCCAWITVSQSFVRLELLKDLMVKLFGEEVLKKRLRELEGKVPQVDDLASYLRTELNERRYFVVLDDVWSTDSWKWINSIAFPRNNNKGSRVIVTTRDVGLAKECTSELLIYRLKPLEITYAKELLLRKANKKIEDMKSDKKMSDIITKIVKKCGYLPLAILTIGGVLATKDPSRAGVRGEFKSCRIHDIMRDIAISISREENFILLPEGTDYDVVHGNTRHIAFHG

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
118-452 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

FIKDELQTIQAFLMAAEASKKSILLKVWVQQVRDLSYDIEDCLDEFTVHVGSQTLSRQLMKLKDRHRIAVQIRNLRTRIEEVSSRNTRYNLIENDLTSTTGERNFIMEDIRNESANNIEEAELVGFSGPKRELLDLIDVHAKDGPTKVVCVVGMGGLGKTTIARKIYESKEDIAKNFSCCAWITVSQSFVRLELLKDLMVKLFGEEVLKKRLRELEGKVPQVDDLASYLRTELNERRYFVVLDDVWSTDSWKWINSIAFPRNNNKGSRVIVTTRDVGLAKECTSELLIYRLKPLEITYAKELLLRKANKKIEDMKSDKKMSDIITKIVKKCGYLP

HMMPanther: PTHR23155:SF148
118-452 PTHR23155:SF148,OS06G0125000 PROTEIN

FIKDELQTIQAFLMAAEASKKSILLKVWVQQVRDLSYDIEDCLDEFTVHVGSQTLSRQLMKLKDRHRIAVQIRNLRTRIEEVSSRNTRYNLIENDLTSTTGERNFIMEDIRNESANNIEEAELVGFSGPKRELLDLIDVHAKDGPTKVVCVVGMGGLGKTTIARKIYESKEDIAKNFSCCAWITVSQSFVRLELLKDLMVKLFGEEVLKKRLRELEGKVPQVDDLASYLRTELNERRYFVVLDDVWSTDSWKWINSIAFPRNNNKGSRVIVTTRDVGLAKECTSELLIYRLKPLEITYAKELLLRKANKKIEDMKSDKKMSDIITKIVKKCGYLP

superfamily: SSF52540
222-464 SSF52540

FIMEDIRNESANNIEEAELVGFSGPKRELLDLIDVHAKDGPTKVVCVVGMGGLGKTTIARKIYESKEDIAKNFSCCAWITVSQSFVRLELLKDLMVKLFGEEVLKKRLRELEGKVPQVDDLASYLRTELNERRYFVVLDDVWSTDSWKWINSIAFPRNNNKGSRVIVTTRDVGLAKECTSELLIYRLKPLEITYAKELLLRKANKKIEDMKSDKKMSDIITKIVKKCGYLPLAILTIGGVLAT

Gene3D: G3DSA:3.40.50.300
247-392 G3DSA:3.40.50.300

KRELLDLIDVHAKDGPTKVVCVVGMGGLGKTTIARKIYESKEDIAKNFSCCAWITVSQSFVRLELLKDLMVKLFGEEVLKKRLRELEGKVPQVDDLASYLRTELNERRYFVVLDDVWSTDSWKWINSIAFPRNNNKGSRVIVTTRD

HMMPfam: PF00931
IPR002182
263-466 NB-ARC,NBS
NB-ARC

TKVVCVVGMGGLGKTTIARKIYESKEDIAKNFSCCAWITVSQSFVRLELLKDLMVKLFGEEVLKKRLRELEGKVPQVDDLASYLRTELNERRYFVVLDDVWSTDSWKWINSIAFPRNNNKGSRVIVTTRDVGLAKECTSELLIYRLKPLEITYAKELLLRKANKKIEDMKSDKKMSDIITKIVKKCGYLPLAILTIGGVLATKD

FPrintScan: PR00364
IPR000767
265-280 DISEASERSIST
Disease resistance protein

VVCVVGMGGLGKTTIA

FPrintScan: PR00364
IPR000767
349-363 DISEASERSIST
Disease resistance protein

ELNERRYFVVLDDVW

FPrintScan: PR00364
IPR000767
448-462 DISEASERSIST
Disease resistance protein

CGYLPLAILTIGGVL


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox