PRGDB00048933 (putative NBS-LRR disease resistance protein)

From PRG Wiki
Jump to: navigation, search
putative NBS-LRR disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 83571777 (DQ285630)
Gene Class NL
Domain Type NBS, LRR, LRR, Others
Gene Species Oryza sativa Indica Group

Comment?

Oryza sativa (indica cultivar-group) putative nitrate-induced NOI protein (75-1-127BAC12.1), putative NBS-LRR disease resistance protein (Nbs1-Pi9), putative NBS-LRR disease resistance protein (Nbs3-Pi9), and NBS-LRR disease resistance protein (Pi9) genes

DNA Sequence

ATGGCCATGTCGCTGGTCGGGAGTGCCATCAGAGTGGCTTCTTCTGCTTCCAGCCAAGAGATGAGCATGCTGATTGGTGTGCAAAACGAGATTTGGTTCATAAAAGATGAGCTGAAGACAATGCAGGCATTCCTGAGGGCGGCTGAAGTAAGGAAAGATCAAGATGAACTCGTGAAGGTGTGGGCTGAGCAAGTGAGAGATCTAGCCTACGACATTGAAGATTGTCTTCAGGAGTTTGCTGTCCATGTTGGGCATCAAAGCCTATCAATGCAGCTGATTAAGCTCTGCCACCGACACCGAATCGCTGTCCAGATTCGGAACCTGAAACAGAGGGTTGAAGAAGTGAGCAATAGAAACATGCGTTACAATCTAATCAAGTCTGTTCCATCTAGCAGTACCGATGACTCCCAAAGCAACATGGAATTGATTCGGTATCAGACTGCTCATTATGTTAATGAATCAGAGCTTGTTGGGTTTGACGTTCCCAAAAAGGAGATCCTGGAGTTGGTATCAAGCAGTGAAAATGCTGAAGCCCAAACAATTTGGATTGTCGGAGAAGGTGGTCTTGGGAAGACTACTCTTGCAAAGAAGGTTTATGAAAGCTCAGATGTTAGTAGCAAGTTCCCGTGTCGTGCTTGGATCACTGTGTCACGATCATTTAATGTCAAGGATTTACTGAAGAACATGATCAAGCAATTACTAGGGGAAGACTCACTCAAGAAACTCTTGGATGAACACAAAGAGGTGATTGTAGAAAAGCACAACCTTACAGACCACCTGAACAAAGGGCTTAGAGGGAGAAGGTATTTTCTTGTTCTTGATGACTTGTGGACCACACAAGCATGGGATTGCATTAAACCTACTTCCTGGGGAAATAACATGGAAGGTAGCCGAGTTGTAGTAACAACAAGAAACAAAAACCTAGCAGGTGGTAGTTCCACCTCGCCAGTCTACTGCCTTAAAACTCTAGAGAAAGAAGATGCTACCAAATTGTTGTTAAGAAAGACAAAAAGAAGTCTGCATGACATAGAAAAAGATCAAATGAAAGAAATATTTGAAAAGATACTAAAGAAATGTGGAGGTCTACCGCTAGCTATAATCACAATAGGTGCAGTCCTTGAAGGGAAAGATATAAAAGAGTGGGAAATTTTGTATGCTCAACTTCCATCAGAACTTGAAAGCAATCCAATCGCTGAACCAATGAAGAAGGTGGTAACCCTTAGTTACAATTACTTGCCATCTCATCTTAAGCCTTGCTTTCTGTACCTTTGCATCTTTCCTGAGGATTTTGATATCCAAAGGAAGCGCCTAGTACATAGATGGATTGCAGAGGGGTTTATTAGAGCTAGGGGTGGAGTGGGAATTGTGGATGTGGCACAAAAGTATTTTGATGAGTTGATCAACCGAAGTATGATTCAAGCATCTAGAGTGGATATAGAGGGAAATATTAAGAGCTGCCGAGTCCATGATATCATGCGTGATGTCATGATATCAATATCTAGGGAAGAAAATTTTGTATACTTGATGGGTGATGATGGAACTAGTGTAGTGGAGGAAAATATTCGCCATTTAGTGCACCATGATACTAGCAAGTGTTCAAATATAGGCATGGATTGGAGCCATGTACGGTCATTAACTTTGTTTGGCAATGAGAGACCCAAAGGGCTATCTCCTTCATTTTGTTTTCCCCAATTGAAGATGCTAAGAGTGCTGGATCTTCAAGATGTCAAATTTGGGATGACACAAAAAGATATCGGAAAAATAGGGTTGCTGCGTCACTTGAAATATGTGAATATTGGAGGGCATTCAAGTATTTATGCACTTCCTAGGTGTATAGGAAAATTAAAAGACTTGTGCACTTTGGACATAACTGACAGTTACATTACAGAACTACCAACTGAGATTAGTAAATTGCAGAGTCTATGTATTCTCCGTTGTAGAGGAAGACCAAACTCGGGGGATTTTAATCTAAATGATCCTAAGGATTGTCTAATTGCCTTCTCATGTTTGCCTCTGCTTATGGCTGCAACCGATTCTGATGAACGTAATAAAATAATTGCTGAGCTACACGTGGGTTGTTCAAGTCAATGGTCTCCTAATGGTGGTACATATGGTGTGAGGGTACCTAGAGGAATCAAGAATTTGAAAAGGCTGCAGGTGCTAGAGACAGTGGATATCAATCGAACCAGCAGTAAGTCAGTTGAAGAGTTGGGAGAGCTTATCCAGCTAAGAAAACTAAGTGTAGTAACACAAGGGTCCACCAAGGAAAAATGCAAAATACTCTGTACAGCCATTCAGAAGCTAACTTCCCTCAAAACTCTCTATCTGAATGCTCATGGACCCTTGGATACTGGAACACTTGAATGGCTACATTCTATTTCCCATCTTCCTTCCCTGAGGATCATCAGATTGATCGGATACATGAAAGAGATGCCCAACTGGTTTAGGGAGCTCAGACAGCTGGTGAAGATTCACTTGCAGAATAGCCAACTAGAGGAGGATAAAACAATGGAGATACTCGGAGAACTGCCTAATCTCATGCTCCTTTTCCTTAGTTGGCGAGCGGTGCTAATCATTCGCAATCAGAAGCAACTGAAAGAGGTGAGATTTGAAGAGGGAACCTCACCCTGGATGGAAAGGATTGATATCAGAGAATGCAGATTGACATCAGGGATTGCTGGTATCAAACACCTTCCGAGGCTTAAGGAGATTTCACTTGAATACAGTGCTAAAGTGGTGAGGCTAGGTCAGCTAGAGGTTGAAATGGGCACACACCCCAATCGACCCATGTTGCGCCTGTTTGGGGAGCGAAGCCGTCATGACCTGGGGAACACCCAAGTAACTGTCGATGAACAACAACTGCAGGTGAGTGTTTTGGAAAATACGATGAATAGTGTTTTCTGTTGTGAACAATGCAGGTCGACACTGGATTGCCGGTCAGACCAGGTGGTGCACGGCAGTCAAACCGGAGATTTTGCTCGAGGCCATGGGAGTATATCCAGTGATGGACCGGGACTAGGCTTGGGAGAAGTTAAAGTCCAGACAGTCAAGAATATCACGCGGGATGCTCATGCTAGAGAACAAATGCATGTGAAGAGGTTCATCGATACGTGTTTTTCTGGACCCCAACGGTTTGACCGGAGTTCATTGTGCGGTCTAACCAGCAGGCGGTCACACCGACGGCAGGGAGGCGGTCCAACTAGTGCAAGGGATGGGAGCAAAAATAAAAACAATCCAATGGTGGTCGACGTAACAAGACAGTTTCAACCACTAGGTATGAAAACAGAGCGGATAGTTGTTGATGGTTGTTAA


Protein sequences

Name Description Sequence
putative NBS-LRR disease resistance protein putative NBS-LRR disease resistance protein [Oryza sativa (indica cultivar-group)].

MAMSLVGSAIRVASSASSQEMSMLIGVQNEIWFIKDELKTMQAFLRAAEVRKDQDELVKVWAEQVRDLAYDIEDCLQEFAVHVGHQSLSMQLIKLCHRHRIAVQIRNLKQRVEEVSNRNMRYNLIKSVPSSSTDDSQSNMELIRYQTAHYVNESELVGFDVPKKEILELVSSSENAEAQTIWIVGEGGLGKTTLAKKVYESSDVSSKFPCRAWITVSRSFNVKDLLKNMIKQLLGEDSLKKLLDEHKEVIVEKHNLTDHLNKGLRGRRYFLVLDDLWTTQAWDCIKPTSWGNNMEGSRVVVTTRNKNLAGGSSTSPVYCLKTLEKEDATKLLLRKTKRSLHDIEKDQMKEIFEKILKKCGGLPLAIITIGAVLEGKDIKEWEILYAQLPSELESNPIAEPMKKVVTLSYNYLPSHLKPCFLYLCIFPEDFDIQRKRLVHRWIAEGFIRARGGVGIVDVAQKYFDELINRSMIQASRVDIEGNIKSCRVHDIMRDVMISISREENFVYLMGDDGTSVVEENIRHLVHHDTSKCSNIGMDWSHVRSLTLFGNERPKGLSPSFCFPQLKMLRVLDLQDVKFGMTQKDIGKIGLLRHLKYVNIGGHSSIYALPRCIGKLKDLCTLDITDSYITELPTEISKLQSLCILRCRGRPNSGDFNLNDPKDCLIAFSCLPLLMAATDSDERNKIIAELHVGCSSQWSPNGGTYGVRVPRGIKNLKRLQVLETVDINRTSSKSVEELGELIQLRKLSVVTQGSTKEKCKILCTAIQKLTSLKTLYLNAHGPLDTGTLEWLHSISHLPSLRIIRLIGYMKEMPNWFRELRQLVKIHLQNSQLEEDKTMEILGELPNLMLLFLSWRAVLIIRNQKQLKEVRFEEGTSPWMERIDIRECRLTSGIAGIKHLPRLKEISLEYSAKVVRLGQLEVEMGTHPNRPMLRLFGERSRHDLGNTQVTVDEQQLQVSVLENTMNSVFCCEQCRSTLDCRSDQVVHGSQTGDFARGHGSISSDGPGLGLGEVKVQTVKNITRDAHAREQMHVKRFIDTCFSGPQRFDRSSLCGLTSRRSHRRQGGGPTSARDGSKNKNNPMVVDVTRQFQPLGMKTERIVVDGC

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
2-953 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

AMSLVGSAIRVASSASSQEMSMLIGVQNEIWFIKDELKTMQAFLRAAEVRKDQDELVKVWAEQVRDLAYDIEDCLQEFAVHVGHQSLSMQLIKLCHRHRIAVQIRNLKQRVEEVSNRNMRYNLIKSVPSSSTDDSQSNMELIRYQTAHYVNESELVGFDVPKKEILELVSSSENAEAQTIWIVGEGGLGKTTLAKKVYESSDVSSKFPCRAWITVSRSFNVKDLLKNMIKQLLGEDSLKKLLDEHKEVIVEKHNLTDHLNKGLRGRRYFLVLDDLWTTQAWDCIKPTSWGNNMEGSRVVVTTRNKNLAGGSSTSPVYCLKTLEKEDATKLLLRKTKRSLHDIEKDQMKEIFEKILKKCGGLPLAIITIGAVLEGKDIKEWEILYAQLPSELESNPIAEPMKKVVTLSYNYLPSHLKPCFLYLCIFPEDFDIQRKRLVHRWIAEGFIRARGGVGIVDVAQKYFDELINRSMIQASRVDIEGNIKSCRVHDIMRDVMISISREENFVYLMGDDGTSVVEENIRHLVHHDTSKCSNIGMDWSHVRSLTLFGNERPKGLSPSFCFPQLKMLRVLDLQDVKFGMTQKDIGKIGLLRHLKYVNIGGHSSIYALPRCIGKLKDLCTLDITDSYITELPTEISKLQSLCILRCRGRPNSGDFNLNDPKDCLIAFSCLPLLMAATDSDERNKIIAELHVGCSSQWSPNGGTYGVRVPRGIKNLKRLQVLETVDINRTSSKSVEELGELIQLRKLSVVTQGSTKEKCKILCTAIQKLTSLKTLYLNAHGPLDTGTLEWLHSISHLPSLRIIRLIGYMKEMPNWFRELRQLVKIHLQNSQLEEDKTMEILGELPNLMLLFLSWRAVLIIRNQKQLKEVRFEEGTSPWMERIDIRECRLTSGIAGIKHLPRLKEISLEYSAKVVRLGQLEVEMGTHPNRPMLRLFGERSRHDLGNTQVTVDEQQ

HMMPanther: PTHR23155:SF149
2-953 PTHR23155:SF149,OS06G0146100 PROTEIN

AMSLVGSAIRVASSASSQEMSMLIGVQNEIWFIKDELKTMQAFLRAAEVRKDQDELVKVWAEQVRDLAYDIEDCLQEFAVHVGHQSLSMQLIKLCHRHRIAVQIRNLKQRVEEVSNRNMRYNLIKSVPSSSTDDSQSNMELIRYQTAHYVNESELVGFDVPKKEILELVSSSENAEAQTIWIVGEGGLGKTTLAKKVYESSDVSSKFPCRAWITVSRSFNVKDLLKNMIKQLLGEDSLKKLLDEHKEVIVEKHNLTDHLNKGLRGRRYFLVLDDLWTTQAWDCIKPTSWGNNMEGSRVVVTTRNKNLAGGSSTSPVYCLKTLEKEDATKLLLRKTKRSLHDIEKDQMKEIFEKILKKCGGLPLAIITIGAVLEGKDIKEWEILYAQLPSELESNPIAEPMKKVVTLSYNYLPSHLKPCFLYLCIFPEDFDIQRKRLVHRWIAEGFIRARGGVGIVDVAQKYFDELINRSMIQASRVDIEGNIKSCRVHDIMRDVMISISREENFVYLMGDDGTSVVEENIRHLVHHDTSKCSNIGMDWSHVRSLTLFGNERPKGLSPSFCFPQLKMLRVLDLQDVKFGMTQKDIGKIGLLRHLKYVNIGGHSSIYALPRCIGKLKDLCTLDITDSYITELPTEISKLQSLCILRCRGRPNSGDFNLNDPKDCLIAFSCLPLLMAATDSDERNKIIAELHVGCSSQWSPNGGTYGVRVPRGIKNLKRLQVLETVDINRTSSKSVEELGELIQLRKLSVVTQGSTKEKCKILCTAIQKLTSLKTLYLNAHGPLDTGTLEWLHSISHLPSLRIIRLIGYMKEMPNWFRELRQLVKIHLQNSQLEEDKTMEILGELPNLMLLFLSWRAVLIIRNQKQLKEVRFEEGTSPWMERIDIRECRLTSGIAGIKHLPRLKEISLEYSAKVVRLGQLEVEMGTHPNRPMLRLFGERSRHDLGNTQVTVDEQQ

superfamily: SSF52540
144-395 SSF52540

RYQTAHYVNESELVGFDVPKKEILELVSSSENAEAQTIWIVGEGGLGKTTLAKKVYESSDVSSKFPCRAWITVSRSFNVKDLLKNMIKQLLGEDSLKKLLDEHKEVIVEKHNLTDHLNKGLRGRRYFLVLDDLWTTQAWDCIKPTSWGNNMEGSRVVVTTRNKNLAGGSSTSPVYCLKTLEKEDATKLLLRKTKRSLHDIEKDQMKEIFEKILKKCGGLPLAIITIGAVLEGKDIKEWEILYAQLPSELESN

Gene3D: G3DSA:3.40.50.300
162-304 G3DSA:3.40.50.300

PKKEILELVSSSENAEAQTIWIVGEGGLGKTTLAKKVYESSDVSSKFPCRAWITVSRSFNVKDLLKNMIKQLLGEDSLKKLLDEHKEVIVEKHNLTDHLNKGLRGRRYFLVLDDLWTTQAWDCIKPTSWGNNMEGSRVVVTTR

HMMPfam: PF00931
IPR002182
167-449 NB-ARC,NBS
NB-ARC

LELVSSSENAEAQTIWIVGEGGLGKTTLAKKVYESSDVSSKFPCRAWITVSRSFNVKDLLKNMIKQLLGEDSLKKLLDEHKEVIVEKHNLTDHLNKGLRGRRYFLVLDDLWTTQAWDCIKPTSWGNNMEGSRVVVTTRNKNLAGGSSTSPVYCLKTLEKEDATKLLLRKTKRSLHDIEKDQMKEIFEKILKKCGGLPLAIITIGAVLEGKDIKEWEILYAQLPSELESNPIAEPMKKVVTLSYNYLPSHLKPCFLYLCIFPEDFDIQRKRLVHRWIAEGFIRA

FPrintScan: PR00364
IPR000767
180-195 DISEASERSIST
Disease resistance protein

TIWIVGEGGLGKTTLA

FPrintScan: PR00364
IPR000767
263-277 DISEASERSIST
Disease resistance protein

GLRGRRYFLVLDDLW

FPrintScan: PR00364
IPR000767
359-373 DISEASERSIST
Disease resistance protein

CGGLPLAIITIGAVL

superfamily: SSF52058
487-908 SSF52058,LRR

RVHDIMRDVMISISREENFVYLMGDDGTSVVEENIRHLVHHDTSKCSNIGMDWSHVRSLTLFGNERPKGLSPSFCFPQLKMLRVLDLQDVKFGMTQKDIGKIGLLRHLKYVNIGGHSSIYALPRCIGKLKDLCTLDITDSYITELPTEISKLQSLCILRCRGRPNSGDFNLNDPKDCLIAFSCLPLLMAATDSDERNKIIAELHVGCSSQWSPNGGTYGVRVPRGIKNLKRLQVLETVDINRTSSKSVEELGELIQLRKLSVVTQGSTKEKCKILCTAIQKLTSLKTLYLNAHGPLDTGTLEWLHSISHLPSLRIIRLIGYMKEMPNWFRELRQLVKIHLQNSQLEEDKTMEILGELPNLMLLFLSWRAVLIIRNQKQLKEVRFEEGTSPWMERIDIRECRLTSGIAGIKHLPRLKEISLEY

Gene3D: G3DSA:3.80.10.10
540-651 G3DSA:3.80.10.10

SHVRSLTLFGNERPKGLSPSFCFPQLKMLRVLDLQDVKFGMTQKDIGKIGLLRHLKYVNIGGHSSIYALPRCIGKLKDLCTLDITDSYITELPTEISKLQSLCILRCRGRPN

Gene3D: G3DSA:3.80.10.10
702-734 G3DSA:3.80.10.10

GTYGVRVPRGIKNLKRLQVLETVDINRTSSKSV

Gene3D: G3DSA:3.80.10.10
735-907 G3DSA:3.80.10.10

EELGELIQLRKLSVVTQGSTKEKCKILCTAIQKLTSLKTLYLNAHGPLDTGTLEWLHSISHLPSLRIIRLIGYMKEMPNWFRELRQLVKIHLQNSQLEEDKTMEILGELPNLMLLFLSWRAVLIIRNQKQLKEVRFEEGTSPWMERIDIRECRLTSGIAGIKHLPRLKEISLE

FPrintScan: PR00364
IPR000767
766-782 DISEASERSIST
Disease resistance protein

QKLTSLKTLYLNAHGPL


List of References

Shaohong Qu, Guifu Liu, Bo Zhou, Maria Bellizzi, Lirong Zeng, Liangying Dai, Bin Han, Guo-Liang Wang
The broad-spectrum blast resistance gene Pi9 encodes a nucleotide-binding site-leucine-rich repeat protein and is a member of a multigene family in rice.
Genetics: 2006, 172(3);1901-14
PubMed:16387888 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox