PRGDB00048934 (putative NBS-LRR disease resistance protein)

From PRG Wiki
Jump to: navigation, search
putative NBS-LRR disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 83571777 (DQ285630)
Gene Class NL
Domain Type NBS, LRR, Others
Gene Species Oryza sativa Indica Group

Comment?

Oryza sativa (indica cultivar-group) putative nitrate-induced NOI protein (75-1-127BAC12.1), putative NBS-LRR disease resistance protein (Nbs1-Pi9), putative NBS-LRR disease resistance protein (Nbs3-Pi9), and NBS-LRR disease resistance protein (Pi9) genes

DNA Sequence

ATGGCGATGTCGGTGCTGGGCAGCGCCGTCGGGAAGGCCGCCTCCGCCGCCGCCGACGAGGCCACCCTCCTGCTCGGCGTCCAGAAGGAGATCTGGTACATCAAGGACGAGCTGAAAACTATTCAGGCATTCTTAAGAGCTGCTGAAGTAACAAAGAAGAAAGATGACTTGCTAAAGGTATGGGCAGAGCAAGTACGAGATCTGTCATATAACATTGAAGATTGCCTAGACGAATTCAAGGTTCATGTTGAGAGCCAAAGCTTGGCAAAGCAACTAATGAAGCTTGGTGAACGCCATCGAATTGCTGTACAGATTCTCAACTTAAAATCAAGAATTGAAGAAGTGAGCAACAGGAATACACGCTACAGCTTAATCAAGCTCATTTCCTCTATAACCACAGAGGATGAGAGGGATTCCTACCTAGAAGATGCTCGCAATCGATCAGGTAGCAACACTGACGAGTCAGAACTTGTGGGCTTTGCCAAGACTAAAGATGAGTTGCTTAAACTGATAGATGTCAATACTAATGACGGTCCAGCTAAAGTGATATGTGTGGTTGGAATGGGTGGATTAGGCAAGACTACCCTTGCAAGGAAGGCATATGAAAACAAGGAACACATGAAGAACTTCTCGTGTTGTGCTTGGATCACTGTGTCTCAGTCATTTGACAGGAAAGAAATTCTGAAACAAATGATCAGGCAACTTCTGGGTGCTGATTCATTAGACAAACTCTTGAAAGAATTTAGTGAGAAGTTGCTCGTGCAAGTCCAGCATCTCGCTGATCACTTGGTTGAAGGGCTAAAGGAGAAAAGGTACTTTGTTGTCCTTGATGACCTATGGACCATAGATGCATGGAATTGGATTCATGATACTGCTTTTCCGAAGATTAACAACAGAGGTAGTCGCATAATAATAACAACGCGAGATGCTGGCTTAGCTGGAAGGTGTACCTCTGAATCACTTATTTACCACCTTGAACCGTTACATATAGATGATGCTATACACTTGCTACTAGCAAAGACAAACATAAGACTTGAAGACATGGAAAATGATGAGGACTTGGGCAGCATAGTTACAAAATTGGTAAAAAGGTGTGGTTATTTACCGCTGGCTATACTCACAATAGGAGGCATTCTTGCTACTAAGAAGATAATGGAATGGGGAAAATTTTACAGAGAACTTCCTTCAGAGCTTGAGAGCAATCCAAGCCTAGAAGCCATGAGGAGGATGGTGACCCTAAGCTACAATCACTTACCATCTCATCTTAAACCATGCTTTCTTTACCTAAGTATTTTCCCTGAAGATTTTGAAATTCAAAGAGGGCGCCTGGTAGATAGATGGATAGCAGAGGGTTTTGTCAGAGCCACAGATGGGGTGAACATTGAGGATGTTGGAAATAGTCACTTTAATGAGCTTATCAACAGAAGTCTGATTCAGCCCTCAAAAGTTAGTACAGATGGAGTTGTTAAGAGATGTCGAATCCATGATATCATGCGTGATATCATAGTTTCAATTTCTAGAGAGGAAAATTTTGTGCTGTTGACTAGGGAGAAGATCACTGTTGTAGCGGAGGAGAGCATCCGCCATCTAGCATTTCATGGGAGCAAATGCTCAAAGATATGCTTGGAGTGGAACCATCTGCGCTCAGTAACTTTGTTTGGTGACAGACCTGCGGGGCGAACACCTGCACTTTGTTCACCACAATTTAGGATGCTGAGAGTGTTGGATCTGGAAGATGCAAAATTCAAATTCACACAAAATGATATCAGGAATATAGGGTTGTTGCGCCACATGAAATATTTGAATTTTGCAAGAGCCTCAACTATTTATACACTTCCAAGGTCCATAGGAAAATTGCAGTGCTTGCAAATTTTGAACATGAGGGAGGCAAATATCTCAGCACTAACAACTGAGGTGACTAAACTCCAGAATCTCCGTAGCCTCCGATGCAGCAGGAGGTCAGGTTCTGGTTACTTTAGCATAATAGATAATCCCAAGGAATGCTTGATGATCACCATGTGCTTACCGATGGTTTTCTCAACTTCAATAAATTTCAGTGACCGTGTGAAGTTAATTCCTGAGATATGCATGTCATGTTCTACCCGTTGGTCTGATACAAAGGGTGTGAGGGTGCCAAGAGGAATTGACAACCTAAAAGAGTTACAGATTCTAGAAGTCGTGGACATCAACAGAACTAGTAGGAAGGCGATTGAAGAGCTGGGGGAGCTAATTCAGTTAAGAAAATTAAGCGTGACAACAAAAGGCGCCACAAATAAGAAGTATCAGATATTTTGTGCAGCGATTGAGAAGCTCTCTTCTCTGCAATCTCTCCGTGTGGATGCTGAGGGATTCTCAGATACTGGAACACTTGAGTGGCTCAATTCGATTGCATGTCCTCCTCCATTCTTGAAGACACTCAAGTTGAATGGATCTCTTGCAGATACACCAAACTGGTTTGGGAACCTTAAGCAGCTGGTGAAGATGTGCTTATCCAGATGTGTGCTACAAGATGGTAAAACTATGGAGATACTTGGGGCACTGCCCAACCTTATGGTTCTTCGTCTTTATCGCAACGCATATGCTGACGAGAAAATGGCATTCAGAAGGGGAACATTCCCAAATCTCAGGTGTCTTGATATTTACTTGCTGAAGCAACTTAGAGAGATAAGATTTGAGGAGGGCACCTCGCCAACAATGGAAAGTATAGAAATTTATGGTTGCAGGTTGGAATCAGGGATTATTGGTATCAAGCACCTTCCAAGACTTAAGATTATTTCGCTTGAATATGATGGTAAAGTCGCGAAGCTTGATGTGCTGCAAGAGGAAGTGAATACACACCCCAATCATACTGAACTGCAAATGGCAGAGGATCGAAGTCATCATGACCTAGGAGATTGTGACCATACATTTTCTTTTACTACATCTTTGCACCCCAAAGCGAAGATACTTTGCCGCCTGCTGATGCTATCTCTAATATCGAATTCTATGCGGATTCCCGTGCAAATAGCACCTCCACGTGGCGCGGCCAGATTCACGGATTCGCTCCCACGCACAGCCGTCCGATTGCATTTCAACGCCTCTCTATCCCCTGCGCCTCCACATGTCGCGGCTACGCGGGCATCTCGTTGGATCTATCATCGGCGGCGAGGAGGCGTGGCGATGGTGCCGAGGTTCATCGGCCGGTGGAGGAACATCGTCGACTTGAGGACCGTGCCCAGGTTCCGCATGGTCCCCAACTACTGCCACCCCGTGGGAGCCGCCGAGGGGGGCAACAACTATGGCTTTCAGATGATAGTTTGA


Protein sequences

Name Description Sequence
putative NBS-LRR disease resistance protein putative NBS-LRR disease resistance protein [Oryza sativa (indica cultivar-group)].

MAMSVLGSAVGKAASAAADEATLLLGVQKEIWYIKDELKTIQAFLRAAEVTKKKDDLLKVWAEQVRDLSYNIEDCLDEFKVHVESQSLAKQLMKLGERHRIAVQILNLKSRIEEVSNRNTRYSLIKLISSITTEDERDSYLEDARNRSGSNTDESELVGFAKTKDELLKLIDVNTNDGPAKVICVVGMGGLGKTTLARKAYENKEHMKNFSCCAWITVSQSFDRKEILKQMIRQLLGADSLDKLLKEFSEKLLVQVQHLADHLVEGLKEKRYFVVLDDLWTIDAWNWIHDTAFPKINNRGSRIIITTRDAGLAGRCTSESLIYHLEPLHIDDAIHLLLAKTNIRLEDMENDEDLGSIVTKLVKRCGYLPLAILTIGGILATKKIMEWGKFYRELPSELESNPSLEAMRRMVTLSYNHLPSHLKPCFLYLSIFPEDFEIQRGRLVDRWIAEGFVRATDGVNIEDVGNSHFNELINRSLIQPSKVSTDGVVKRCRIHDIMRDIIVSISREENFVLLTREKITVVAEESIRHLAFHGSKCSKICLEWNHLRSVTLFGDRPAGRTPALCSPQFRMLRVLDLEDAKFKFTQNDIRNIGLLRHMKYLNFARASTIYTLPRSIGKLQCLQILNMREANISALTTEVTKLQNLRSLRCSRRSGSGYFSIIDNPKECLMITMCLPMVFSTSINFSDRVKLIPEICMSCSTRWSDTKGVRVPRGIDNLKELQILEVVDINRTSRKAIEELGELIQLRKLSVTTKGATNKKYQIFCAAIEKLSSLQSLRVDAEGFSDTGTLEWLNSIACPPPFLKTLKLNGSLADTPNWFGNLKQLVKMCLSRCVLQDGKTMEILGALPNLMVLRLYRNAYADEKMAFRRGTFPNLRCLDIYLLKQLREIRFEEGTSPTMESIEIYGCRLESGIIGIKHLPRLKIISLEYDGKVAKLDVLQEEVNTHPNHTELQMAEDRSHHDLGDCDHTFSFTTSLHPKAKILCRLLMLSLISNSMRIPVQIAPPRGAARFTDSLPRTAVRLHFNASLSPAPPHVAATRASRWIYHRRRGGVAMVPRFIGRWRNIVDLRTVPRFRMVPNYCHPVGAAEGGNNYGFQMIV

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
8-964 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

SAVGKAASAAADEATLLLGVQKEIWYIKDELKTIQAFLRAAEVTKKKDDLLKVWAEQVRDLSYNIEDCLDEFKVHVESQSLAKQLMKLGERHRIAVQILNLKSRIEEVSNRNTRYSLIKLISSITTEDERDSYLEDARNRSGSNTDESELVGFAKTKDELLKLIDVNTNDGPAKVICVVGMGGLGKTTLARKAYENKEHMKNFSCCAWITVSQSFDRKEILKQMIRQLLGADSLDKLLKEFSEKLLVQVQHLADHLVEGLKEKRYFVVLDDLWTIDAWNWIHDTAFPKINNRGSRIIITTRDAGLAGRCTSESLIYHLEPLHIDDAIHLLLAKTNIRLEDMENDEDLGSIVTKLVKRCGYLPLAILTIGGILATKKIMEWGKFYRELPSELESNPSLEAMRRMVTLSYNHLPSHLKPCFLYLSIFPEDFEIQRGRLVDRWIAEGFVRATDGVNIEDVGNSHFNELINRSLIQPSKVSTDGVVKRCRIHDIMRDIIVSISREENFVLLTREKITVVAEESIRHLAFHGSKCSKICLEWNHLRSVTLFGDRPAGRTPALCSPQFRMLRVLDLEDAKFKFTQNDIRNIGLLRHMKYLNFARASTIYTLPRSIGKLQCLQILNMREANISALTTEVTKLQNLRSLRCSRRSGSGYFSIIDNPKECLMITMCLPMVFSTSINFSDRVKLIPEICMSCSTRWSDTKGVRVPRGIDNLKELQILEVVDINRTSRKAIEELGELIQLRKLSVTTKGATNKKYQIFCAAIEKLSSLQSLRVDAEGFSDTGTLEWLNSIACPPPFLKTLKLNGSLADTPNWFGNLKQLVKMCLSRCVLQDGKTMEILGALPNLMVLRLYRNAYADEKMAFRRGTFPNLRCLDIYLLKQLREIRFEEGTSPTMESIEIYGCRLESGIIGIKHLPRLKIISLEYDGKVAKLDVLQEEVNTHPNHTELQMAEDRSHHDLG

HMMPanther: PTHR11017:SF129
8-964 PTHR11017:SF129

SAVGKAASAAADEATLLLGVQKEIWYIKDELKTIQAFLRAAEVTKKKDDLLKVWAEQVRDLSYNIEDCLDEFKVHVESQSLAKQLMKLGERHRIAVQILNLKSRIEEVSNRNTRYSLIKLISSITTEDERDSYLEDARNRSGSNTDESELVGFAKTKDELLKLIDVNTNDGPAKVICVVGMGGLGKTTLARKAYENKEHMKNFSCCAWITVSQSFDRKEILKQMIRQLLGADSLDKLLKEFSEKLLVQVQHLADHLVEGLKEKRYFVVLDDLWTIDAWNWIHDTAFPKINNRGSRIIITTRDAGLAGRCTSESLIYHLEPLHIDDAIHLLLAKTNIRLEDMENDEDLGSIVTKLVKRCGYLPLAILTIGGILATKKIMEWGKFYRELPSELESNPSLEAMRRMVTLSYNHLPSHLKPCFLYLSIFPEDFEIQRGRLVDRWIAEGFVRATDGVNIEDVGNSHFNELINRSLIQPSKVSTDGVVKRCRIHDIMRDIIVSISREENFVLLTREKITVVAEESIRHLAFHGSKCSKICLEWNHLRSVTLFGDRPAGRTPALCSPQFRMLRVLDLEDAKFKFTQNDIRNIGLLRHMKYLNFARASTIYTLPRSIGKLQCLQILNMREANISALTTEVTKLQNLRSLRCSRRSGSGYFSIIDNPKECLMITMCLPMVFSTSINFSDRVKLIPEICMSCSTRWSDTKGVRVPRGIDNLKELQILEVVDINRTSRKAIEELGELIQLRKLSVTTKGATNKKYQIFCAAIEKLSSLQSLRVDAEGFSDTGTLEWLNSIACPPPFLKTLKLNGSLADTPNWFGNLKQLVKMCLSRCVLQDGKTMEILGALPNLMVLRLYRNAYADEKMAFRRGTFPNLRCLDIYLLKQLREIRFEEGTSPTMESIEIYGCRLESGIIGIKHLPRLKIISLEYDGKVAKLDVLQEEVNTHPNHTELQMAEDRSHHDLG

superfamily: SSF52540
140-401 SSF52540

YLEDARNRSGSNTDESELVGFAKTKDELLKLIDVNTNDGPAKVICVVGMGGLGKTTLARKAYENKEHMKNFSCCAWITVSQSFDRKEILKQMIRQLLGADSLDKLLKEFSEKLLVQVQHLADHLVEGLKEKRYFVVLDDLWTIDAWNWIHDTAFPKINNRGSRIIITTRDAGLAGRCTSESLIYHLEPLHIDDAIHLLLAKTNIRLEDMENDEDLGSIVTKLVKRCGYLPLAILTIGGILATKKIMEWGKFYRELPSELESN

Gene3D: G3DSA:3.40.50.300
151-312 G3DSA:3.40.50.300

NTDESELVGFAKTKDELLKLIDVNTNDGPAKVICVVGMGGLGKTTLARKAYENKEHMKNFSCCAWITVSQSFDRKEILKQMIRQLLGADSLDKLLKEFSEKLLVQVQHLADHLVEGLKEKRYFVVLDDLWTIDAWNWIHDTAFPKINNRGSRIIITTRDAGL

HMMPfam: PF00931
IPR002182
178-457 NB-ARC,NBS
NB-ARC

GPAKVICVVGMGGLGKTTLARKAYENKEHMKNFSCCAWITVSQSFDRKEILKQMIRQLLGADSLDKLLKEFSEKLLVQVQHLADHLVEGLKEKRYFVVLDDLWTIDAWNWIHDTAFPKINNRGSRIIITTRDAGLAGRCTSESLIYHLEPLHIDDAIHLLLAKTNIRLEDMENDEDLGSIVTKLVKRCGYLPLAILTIGGILATKKIMEWGKFYRELPSELESNPSLEAMRRMVTLSYNHLPSHLKPCFLYLSIFPEDFEIQRGRLVDRWIAEGFVRATD

FPrintScan: PR00364
IPR000767
182-197 DISEASERSIST
Disease resistance protein

VICVVGMGGLGKTTLA

FPrintScan: PR00364
IPR000767
266-280 DISEASERSIST
Disease resistance protein

GLKEKRYFVVLDDLW

FPrintScan: PR00364
IPR000767
365-379 DISEASERSIST
Disease resistance protein

CGYLPLAILTIGGIL

superfamily: SSF52058
493-929 SSF52058,LRR

RIHDIMRDIIVSISREENFVLLTREKITVVAEESIRHLAFHGSKCSKICLEWNHLRSVTLFGDRPAGRTPALCSPQFRMLRVLDLEDAKFKFTQNDIRNIGLLRHMKYLNFARASTIYTLPRSIGKLQCLQILNMREANISALTTEVTKLQNLRSLRCSRRSGSGYFSIIDNPKECLMITMCLPMVFSTSINFSDRVKLIPEICMSCSTRWSDTKGVRVPRGIDNLKELQILEVVDINRTSRKAIEELGELIQLRKLSVTTKGATNKKYQIFCAAIEKLSSLQSLRVDAEGFSDTGTLEWLNSIACPPPFLKTLKLNGSLADTPNWFGNLKQLVKMCLSRCVLQDGKTMEILGALPNLMVLRLYRNAYADEKMAFRRGTFPNLRCLDIYLLKQLREIRFEEGTSPTMESIEIYGCRLESGIIGIKHLPRLKIISLEY

Gene3D: G3DSA:3.80.10.10
545-655 G3DSA:3.80.10.10

NHLRSVTLFGDRPAGRTPALCSPQFRMLRVLDLEDAKFKFTQNDIRNIGLLRHMKYLNFARASTIYTLPRSIGKLQCLQILNMREANISALTTEVTKLQNLRSLRCSRRSG

Gene3D: G3DSA:3.80.10.10
705-772 G3DSA:3.80.10.10

DTKGVRVPRGIDNLKELQILEVVDINRTSRKAIEELGELIQLRKLSVTTKGATNKKYQIFCAAIEKLS

FPrintScan: PR00364
IPR000767
719-735 DISEASERSIST
Disease resistance protein

KELQILEVVDINRTSRK

Gene3D: G3DSA:3.80.10.10
773-928 G3DSA:3.80.10.10

SLQSLRVDAEGFSDTGTLEWLNSIACPPPFLKTLKLNGSLADTPNWFGNLKQLVKMCLSRCVLQDGKTMEILGALPNLMVLRLYRNAYADEKMAFRRGTFPNLRCLDIYLLKQLREIRFEEGTSPTMESIEIYGCRLESGIIGIKHLPRLKIISLE


List of References

Shaohong Qu, Guifu Liu, Bo Zhou, Maria Bellizzi, Lirong Zeng, Liangying Dai, Bin Han, Guo-Liang Wang
The broad-spectrum blast resistance gene Pi9 encodes a nucleotide-binding site-leucine-rich repeat protein and is a member of a multigene family in rice.
Genetics: 2006, 172(3);1901-14
PubMed:16387888 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox