PRGDB00048936 (disease resistance protein, putative)

From PRG Wiki
Jump to: navigation, search
disease resistance protein, putative
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 21407507 (AY088733)
Gene Class TNL
Domain Type NBS, TIR, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana clone 93530 mRNA, complete sequence.

DNA Sequence

ATGGCTGCATCTACTTCTTCTTCTTCTTCATCATCATCATCTTCTTCTTTATCTTCTCCTTCACCTTGCACATGGAGATACATGACTTTCACGAGCTTCCATGGACCAGATGTCCGCAACACATTTCTTAGTCATTTGAGGAAACAGTTTAACACCAATGGAATTACGATGTTTGATGATCAAAGGATGGAGAGAAGCCAAACCCTTGCCCCTACTCTCACGCAGGCGATTAGAGAATCGAAGATCTACATCGTCTTGCTCTCGAAGAACTATGCTTCATCGAGCTGGTGTCTTGATGAGCTATTGGAGATTTTAAACTGCAAAGAAAAAAGAGGACAGAGAGTGATGACAATCTTCTACGGCGTAAATCCATCTGATGTGCGGAAACAAACCGGAGAATTTGGAATCGCTTTCAACGAAACTTGTGCTCGTAAAACAGAGGAGGAGAGGAGAAAATGGAGCCACGCTTTGACCTGTGTGAGCAACATAACCGGAGTACACGTCCAAGACAGGGACGATGAGGCAAACATGATCGAGAAAATTGCAACTGATGTCTCAGAAAAACTGAATGCTACAGAGTCAAAGGATTTTGATGAAATGGTGGGAATTAAAGCTCATTTGACGAAAATTGAGTCTTTGCTATCTTTAGATTATGATAAAGTTAAGATCGTTGGGATCTCCGGTCCTGCAGGCATTGGTAAGAGTACCATTGCCAGAGCCTTACATAACCTACTCTCTAGCAGTTTTCATCTTAGTTGTTTTATGGAAAACCTTATTAGCCAAAGCAACCCCCATAGTTCTCTAGAGTATAGTTCGAAATTGAGTTTACAAGAGCAGCTTCTTTCACAAGTTTTGAACGAAAAGGACATTAGGATACGCCATTTAGGTGCGATACAAGAAAGGCTACACGACCAGAGGGTTCTTATCATTCTTGATGACGTGACGAGTCTAGAGCAACTAGAGGTTTTGGCTAATATCAAGTGGTATGGTCCTGGAAGTAGGATCATAGTAATCACTAAAAAGAAAGATATTTTGGTGCAACATGGTATCTGTGATATATACCATGTGGGTTTTCCATCAGATGCAGATGCTCTAAAGATCTTTTGTCTATCTGCTTATAGACAAACCTCTCCACCTGATGGATCTATGAAACTTCATGAGTGCGAAATGTTTATAAAAATTTGTGGCAATCTTCCATTGCATCTGCATGTTTTGGGGTCGGCGCTTCGGGGAAGGAGTTATGGCAGAGTGCAGAGTTTGTGTAATCTAGTGTCTCTGGCTGATTTTGTATAA


Protein sequences

Name Description Sequence
disease resistance protein, putative disease resistance protein, putative [Arabidopsis thaliana].

MAASTSSSSSSSSSSSLSSPSPCTWRYMTFTSFHGPDVRNTFLSHLRKQFNTNGITMFDDQRMERSQTLAPTLTQAIRESKIYIVLLSKNYASSSWCLDELLEILNCKEKRGQRVMTIFYGVNPSDVRKQTGEFGIAFNETCARKTEEERRKWSHALTCVSNITGVHVQDRDDEANMIEKIATDVSEKLNATESKDFDEMVGIKAHLTKIESLLSLDYDKVKIVGISGPAGIGKSTIARALHNLLSSSFHLSCFMENLISQSNPHSSLEYSSKLSLQEQLLSQVLNEKDIRIRHLGAIQERLHDQRVLIILDDVTSLEQLEVLANIKWYGPGSRIIVITKKKDILVQHGICDIYHVGFPSDADALKIFCLSAYRQTSPPDGSMKLHECEMFIKICGNLPLHLHVLGSALRGRSYGRVQSLCNLVSLADFV

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
15-166 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SSLSSPSPCTWRYMTFTSFHGPDVRNTFLSHLRKQFNTNGITMFDDQRMERSQTLAPTLTQAIRESKIYIVLLSKNYASSSWCLDELLEILNCKEKRGQRVMTIFYGVNPSDVRKQTGEFGIAFNETCARKTEEERRKWSHALTCVSNITGV

Gene3D: G3DSA:3.40.50.10140
24-160 G3DSA:3.40.50.10140

TWRYMTFTSFHGPDVRNTFLSHLRKQFNTNGITMFDDQRMERSQTLAPTLTQAIRESKIYIVLLSKNYASSSWCLDELLEILNCKEKRGQRVMTIFYGVNPSDVRKQTGEFGIAFNETCARKTEEERRKWSHALTCV

ProfileScan: PS50104
IPR000157
25-163 TIR
Toll/interleukin-1 receptor homology (TIR) domain

WRYMTFTSFHGPDVRNTFLSHLRKQFNTNGITMFDDQRMERSQTLAPTLTQAIRESKIYIVLLSKNYASSSWCLDELLEILNCKEKRGQRVMTIFYGVNPSDVRKQTGEFGIAFNETCARKTEEERRKWSHALTCVSNI

HMMSmart: SM00255
IPR000157
26-163 TIR
Toll/interleukin-1 receptor homology (TIR) domain

RYMTFTSFHGPDVRNTFLSHLRKQFNTNGITMFDDQRMERSQTLAPTLTQAIRESKIYIVLLSKNYASSSWCLDELLEILNCKEKRGQRVMTIFYGVNPSDVRKQTGEFGIAFNETCARKTEEERRKWSHALTCVSNI

HMMPfam: PF01582
IPR000157
30-158 TIR
Toll/interleukin-1 receptor homology (TIR) domain

FTSFHGPDVRNTFLSHLRKQFNTNGITMFDDQRMERSQTLAPTLTQAIRESKIYIVLLSKNYASSSWCLDELLEILNCKEKRGQRVMTIFYGVNPSDVRKQTGEFGIAFNETCARKTEEERRKWSHALT

HMMPanther: PTHR11017:SF20
49-412 PTHR11017:SF20,SUBFAMILY NOT NAMED

QFNTNGITMFDDQRMERSQTLAPTLTQAIRESKIYIVLLSKNYASSSWCLDELLEILNCKEKRGQRVMTIFYGVNPSDVRKQTGEFGIAFNETCARKTEEERRKWSHALTCVSNITGVHVQDRDDEANMIEKIATDVSEKLNATESKDFDEMVGIKAHLTKIESLLSLDYDKVKIVGISGPAGIGKSTIARALHNLLSSSFHLSCFMENLISQSNPHSSLEYSSKLSLQEQLLSQVLNEKDIRIRHLGAIQERLHDQRVLIILDDVTSLEQLEVLANIKWYGPGSRIIVITKKKDILVQHGICDIYHVGFPSDADALKIFCLSAYRQTSPPDGSMKLHECEMFIKICGNLPLHLHVLGSALRGR

HMMPanther: PTHR11017
49-412 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

QFNTNGITMFDDQRMERSQTLAPTLTQAIRESKIYIVLLSKNYASSSWCLDELLEILNCKEKRGQRVMTIFYGVNPSDVRKQTGEFGIAFNETCARKTEEERRKWSHALTCVSNITGVHVQDRDDEANMIEKIATDVSEKLNATESKDFDEMVGIKAHLTKIESLLSLDYDKVKIVGISGPAGIGKSTIARALHNLLSSSFHLSCFMENLISQSNPHSSLEYSSKLSLQEQLLSQVLNEKDIRIRHLGAIQERLHDQRVLIILDDVTSLEQLEVLANIKWYGPGSRIIVITKKKDILVQHGICDIYHVGFPSDADALKIFCLSAYRQTSPPDGSMKLHECEMFIKICGNLPLHLHVLGSALRGR

superfamily: SSF52540
80-421 SSF52540

SKIYIVLLSKNYASSSWCLDELLEILNCKEKRGQRVMTIFYGVNPSDVRKQTGEFGIAFNETCARKTEEERRKWSHALTCVSNITGVHVQDRDDEANMIEKIATDVSEKLNATESKDFDEMVGIKAHLTKIESLLSLDYDKVKIVGISGPAGIGKSTIARALHNLLSSSFHLSCFMENLISQSNPHSSLEYSSKLSLQEQLLSQVLNEKDIRIRHLGAIQERLHDQRVLIILDDVTSLEQLEVLANIKWYGPGSRIIVITKKKDILVQHGICDIYHVGFPSDADALKIFCLSAYRQTSPPDGSMKLHECEMFIKICGNLPLHLHVLGSALRGRSYGRVQSLC

Gene3D: G3DSA:3.40.50.300
194-256 G3DSA:3.40.50.300

SKDFDEMVGIKAHLTKIESLLSLDYDKVKIVGISGPAGIGKSTIARALHNLLSSSFHLSCFME

HMMPfam: PF00931
IPR002182
204-413 NB-ARC,NBS
NB-ARC

KAHLTKIESLLSLDYDKVKIVGISGPAGIGKSTIARALHNLLSSSFHLSCFMENLISQSNPHSSLEYSSKLSLQEQLLSQVLNEKDIRIRHLGAIQERLHDQRVLIILDDVTSLEQLEVLANIKWYGPGSRIIVITKKKDILVQHGICDIYHVGFPSDADALKIFCLSAYRQTSPPDGSMKLHECEMFIKICGNLPLHLHVLGSALRGRS

HMMSmart: SM00382
IPR003593
220-360 AAA,NBS
AAA+ ATPase domain

KVKIVGISGPAGIGKSTIARALHNLLSSSFHLSCFMENLISQSNPHSSLEYSSKLSLQEQLLSQVLNEKDIRIRHLGAIQERLHDQRVLIILDDVTSLEQLEVLANIKWYGPGSRIIVITKKKDILVQHGICDIYHVGFPS

FPrintScan: PR00364
IPR000767
223-238 DISEASERSIST
Disease resistance protein

IVGISGPAGIGKSTIA

Gene3D: G3DSA:3.40.50.300
289-319 G3DSA:3.40.50.300

DIRIRHLGAIQERLHDQRVLIILDDVTSLEQ

FPrintScan: PR00364
IPR000767
301-315 DISEASERSIST
Disease resistance protein

RLHDQRVLIILDDVT

FPrintScan: PR00364
IPR000767
395-409 DISEASERSIST
Disease resistance protein

CGNLPLHLHVLGSAL


List of References

Brian J Haas, Natalia Volfovsky, Christopher D Town, Maxim Troukhan, Nickolai Alexandrov, Kenneth A Feldmann, Richard B Flavell, Owen White, Steven L Salzberg
Full-length messenger RNA sequences greatly improve genome annotation.
Genome Biol.: 2002, 3(6);RESEARCH0029
PubMed:12093376 WorldCat.org (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox