PRGDB00048937 (putative leucine-rich repeat disease resistance protein)

From PRG Wiki
Jump to: navigation, search
putative leucine-rich repeat disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 21404768 (AY086058)
Gene Class Unknown
Domain Type LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana clone 20900 mRNA, complete sequence.

DNA Sequence

ATGACTTGCCTTCTTCTTCTTCTCCTCCTCCTCCTCTTCCTCTTCTCCTCTGCCGACTCTCTGACGTCACCATCCGACGTGTCAGCTTTAAAAGCTTTCAAAGCCACCGTGAAACCCAACTCAATCCCACCGTGGTCTTGTCTCGCTAGCTGGGACTTTACTGTCTCCGACCCATGTGCTTCACCACGTCGAACACATTTCACTTGCGGCATCACTTGCTCGTCTGACTCCACACGTGTGACCCAACTCACTCTCGACCCAGCCGGGTACACGGGTCGTCTCACGCCTCTCATCTCCGGCCTCACAGAGCTTCTCACGCTCGATCTCGCCGAGAACAACTTCTACGGCCTAATCCCATCCTCCATCTCCTCCCTCACCAGCCTCAAGACCTTGATCCTCCGATCCAACTCGTTTTCCGGGTCATTACCCGACTCAGTAACTCGACTCAACTCACTCGAATCCATTGACATATCTCACAACTCTCTCACCGGGCCGCTTCCAAAAACAATGAACTCGCTTTCAAATCTCCGACAACTCGATCTTAGCTACAACAAGCTCACCGGAGCCATCCCAAAGCTTCCGAAAAACCTCATCGATTTAGCTTTAAAGGCGAATACTTTATCAGGACCCATCTCAAAAGACTCATTCACCGAGTCAACTCAGCTCGAAATCGTCGAACTCGCTGAGAACTCATTCACCGGAACACTCGGAGCTTGGTTCTTCCTACTTGAATCAATCCAACAAGTCGATCTAGCGAACAACACTCTCACAGGCATCGAAGTCCTCCCTCCAAACCTCGCCGGAGAAAACAACCTCGTAGCTGTAGAGCTAGGATTCAACCAAATCAGAGGAAACGCTCCGGCGAGTTTCGCGGCGTATCCAAGACTTTCTTCACTATCTATGAGATACAACGTGCTTCACGGTGTTATACCGTCGGAATACGAACGGAGCAAGACATTAAGACGGCTTTACTTAGACGGGAACTTCTTGACGGGAAAACCTCCGGCGAGATTTGTGAGAACAGACGCAGAAGTAATGGGAAGTTTGGGGAATAATTGTCTACAGGGATGTCCAGGGAAAGCTAAGGTGTGTGCTCCATCGCAGAAACCATTTTACATTTGTAAGCAAGCTTATGGTGGAAAACCAAAGTCTTAG


Protein sequences

Name Description Sequence
putative leucine-rich repeat disease resistance protein putative leucine-rich repeat disease resistance protein [Arabidopsis thaliana].

MTCLLLLLLLLLFLFSSADSLTSPSDVSALKAFKATVKPNSIPPWSCLASWDFTVSDPCASPRRTHFTCGITCSSDSTRVTQLTLDPAGYTGRLTPLISGLTELLTLDLAENNFYGLIPSSISSLTSLKTLILRSNSFSGSLPDSVTRLNSLESIDISHNSLTGPLPKTMNSLSNLRQLDLSYNKLTGAIPKLPKNLIDLALKANTLSGPISKDSFTESTQLEIVELAENSFTGTLGAWFFLLESIQQVDLANNTLTGIEVLPPNLAGENNLVAVELGFNQIRGNAPASFAAYPRLSSLSMRYNVLHGVIPSEYERSKTLRRLYLDGNFLTGKPPARFVRTDAEVMGSLGNNCLQGCPGKAKVCAPSQKPFYICKQAYGGKPKS


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
5-358 PTHR24420,FAMILY NOT NAMED

LLLLLLLLFLFSSADSLTSPSDVSALKAFKATVKPNSIPPWSCLASWDFTVSDPCASPRRTHFTCGITCSSDSTRVTQLTLDPAGYTGRLTPLISGLTELLTLDLAENNFYGLIPSSISSLTSLKTLILRSNSFSGSLPDSVTRLNSLESIDISHNSLTGPLPKTMNSLSNLRQLDLSYNKLTGAIPKLPKNLIDLALKANTLSGPISKDSFTESTQLEIVELAENSFTGTLGAWFFLLESIQQVDLANNTLTGIEVLPPNLAGENNLVAVELGFNQIRGNAPASFAAYPRLSSLSMRYNVLHGVIPSEYERSKTLRRLYLDGNFLTGKPPARFVRTDAEVMGSLGNNCLQGCP

HMMPanther: PTHR24420:SF473
5-358 PTHR24420:SF473,SUBFAMILY NOT NAMED

LLLLLLLLFLFSSADSLTSPSDVSALKAFKATVKPNSIPPWSCLASWDFTVSDPCASPRRTHFTCGITCSSDSTRVTQLTLDPAGYTGRLTPLISGLTELLTLDLAENNFYGLIPSSISSLTSLKTLILRSNSFSGSLPDSVTRLNSLESIDISHNSLTGPLPKTMNSLSNLRQLDLSYNKLTGAIPKLPKNLIDLALKANTLSGPISKDSFTESTQLEIVELAENSFTGTLGAWFFLLESIQQVDLANNTLTGIEVLPPNLAGENNLVAVELGFNQIRGNAPASFAAYPRLSSLSMRYNVLHGVIPSEYERSKTLRRLYLDGNFLTGKPPARFVRTDAEVMGSLGNNCLQGCP

superfamily: SSF52058
20-340 SSF52058,LRR

SLTSPSDVSALKAFKATVKPNSIPPWSCLASWDFTVSDPCASPRRTHFTCGITCSSDSTRVTQLTLDPAGYTGRLTPLISGLTELLTLDLAENNFYGLIPSSISSLTSLKTLILRSNSFSGSLPDSVTRLNSLESIDISHNSLTGPLPKTMNSLSNLRQLDLSYNKLTGAIPKLPKNLIDLALKANTLSGPISKDSFTESTQLEIVELAENSFTGTLGAWFFLLESIQQVDLANNTLTGIEVLPPNLAGENNLVAVELGFNQIRGNAPASFAAYPRLSSLSMRYNVLHGVIPSEYERSKTLRRLYLDGNFLTGKPPARFVR

Gene3D: G3DSA:3.80.10.10
58-204 G3DSA:3.80.10.10

PCASPRRTHFTCGITCSSDSTRVTQLTLDPAGYTGRLTPLISGLTELLTLDLAENNFYGLIPSSISSLTSLKTLILRSNSFSGSLPDSVTRLNSLESIDISHNSLTGPLPKTMNSLSNLRQLDLSYNKLTGAIPKLPKNLIDLALKA

ProfileScan: PS51450
IPR001611
103-124 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ELLTLDLAENNFYGLIPSSISS

HMMPfam: PF13855
126-186 LRR_8,Leucine rich repeat

TSLKTLILRSNSFSGSLPDSVTRLNSLESIDISHNSLTGPLPKTMNSLSNLRQLDLSYNKL

ProfileScan: PS51450
IPR001611
127-149 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKTLILRSNSFSGSLPDSVTRL

ProfileScan: PS51450
IPR001611
151-173 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLESIDISHNSLTGPLPKTMNSL

FPrintScan: PR00019
152-165 LEURICHRPT,Leucine-rich repeat signature

LESIDISHNSLTGP

FPrintScan: PR00019
173-186 LEURICHRPT,Leucine-rich repeat signature

LSNLRQLDLSYNKL

ProfileScan: PS51450
IPR001611
175-197 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLRQLDLSYNKLTGAIPKLPKNL

Gene3D: G3DSA:3.80.10.10
205-358 G3DSA:3.80.10.10

NTLSGPISKDSFTESTQLEIVELAENSFTGTLGAWFFLLESIQQVDLANNTLTGIEVLPPNLAGENNLVAVELGFNQIRGNAPASFAAYPRLSSLSMRYNVLHGVIPSEYERSKTLRRLYLDGNFLTGKPPARFVRTDAEVMGSLGNNCLQGCP

ProfileScan: PS51450
IPR001611
245-266 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SIQQVDLANNTLTGIEVLPPNL

ProfileScan: PS51450
IPR001611
319-340 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

TLRRLYLDGNFLTGKPPARFVR


List of References

Brian J Haas, Natalia Volfovsky, Christopher D Town, Maxim Troukhan, Nickolai Alexandrov, Kenneth A Feldmann, Richard B Flavell, Owen White, Steven L Salzberg
Full-length messenger RNA sequences greatly improve genome annotation.
Genome Biol.: 2002, 3(6);RESEARCH0029
PubMed:12093376 WorldCat.org (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox