PRGDB00048938 (putative disease resistance protein)

From PRG Wiki
Jump to: navigation, search
putative disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 21403060 (AY084350)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana clone 105146 mRNA, complete sequence.

DNA Sequence

ATGAACTCTTCCTTTACTCTCTTCATCTTTACCTTCGTCATCTTCCTCCAATGTCTAAATCCCACCGGAGCTGCCACGTGTCATCCTGATGATGAAGCGGGTCTTCTAGCTTTCAAAGCGGGTATAACCCGAGATCCTTCGGGTATTCTCAGTTCTTGGAAGAAAGGTACCGCTTGTTGTTCTTGGAACGGTGTCACTTGTCTCACCACTGACCGTGTCTCTGCACTCTCTGTCGCTGGACAAGCCGATGTTGCTGGAAGCTTCCTCTCCGGCACTCTCTCGCCGTCGTTGGCTAAACTCAAGCACCTTGATGGGATTTACTTCACCGATCTCAAGAACATCACTGGTTCTTTTCCTCAATTCCTTTTCCAATTACCAAATCTTAAGTACGTATACATTGAGAATAACCGTCTCTCTGGTCCTCTTCCGGCTAACATCGGTGCGCTAAGCCAGCTTGAAGCGTTCAGCCTCGAGGGAAACCGGTTCACCGGTCCGATCCCGAGCTCGATATCTAATTTGACTCGGTTAACTCAACTCAAACTCGGCAATAATCTTCTAACCGGAACTATACCGTTAGGGGTCGCTAATCTCAAGCTCATGTCGTATCTCAACCTTGGAGGTAACCGTCTCACTGGAACCATTCCAGATATTTTCAAATCCATGCCAGAGCTCCGATCTTTAACTCTCTCCCGCAACGGATTCTCCGGGAATCTTCCTCCGTCCATTGCATCACTCGCACCGATTCTTAGGTTCCTCGAGTTAGGCCATAACAAACTCTCCGGGACGATTCCAAACTTTTTATCAAACTTCAAGGCGCTCGACACATTGGATCTCTCCAAGAATCGGTTCTCGGGTGTCATACCGAAGAGTTTCGCCAATCTGACCAAGATATTCAATCTTGATCTCTCCCATAATCTTCTAACCGATCCATTCCCTGTCTTGAACGTTAAAGGCATTGAATCTCTGGATCTCTCGTACAACAAGTTTCACTTGAATACGATCCCGAAATGGGTGACTTCGTCGCCGATCATCTTCTCGTTGAAGCTAGCAAAATGCGGGATCAAGATGAGCTTAGACGATTGGAAGCCAGCGCAAACATTCTACTATGATTTCATCGATCTGTCGGAAAACGAGATCACAGGTAGTCCAGCAAGGTTCTTGAACCAAACAGAGTATCTAGTGGAGTTCAAGGCAGCGGGTAACAAACTACGATTCGATATGGGGAAGCTAACGTTTGCAAAGACGCTGACAACTTTAGATATATCAAGGAACTTGGTATTTGGGAAGGTGCCGGCAATGGTGGCTGGACTAAAGACATTGAACGTGAGTCACAACCATCTTTGTGGAAAGCTTCCAGTAACAAAGTTCCCGGCCAGTGCGTTTGTGGGTAATGACTGTCTTTGCGGCTCTCCTCTTTCTCCTTGTAAAGCTTAA


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Arabidopsis thaliana].

MNSSFTLFIFTFVIFLQCLNPTGAATCHPDDEAGLLAFKAGITRDPSGILSSWKKGTACCSWNGVTCLTTDRVSALSVAGQADVAGSFLSGTLSPSLAKLKHLDGIYFTDLKNITGSFPQFLFQLPNLKYVYIENNRLSGPLPANIGALSQLEAFSLEGNRFTGPIPSSISNLTRLTQLKLGNNLLTGTIPLGVANLKLMSYLNLGGNRLTGTIPDIFKSMPELRSLTLSRNGFSGNLPPSIASLAPILRFLELGHNKLSGTIPNFLSNFKALDTLDLSKNRFSGVIPKSFANLTKIFNLDLSHNLLTDPFPVLNVKGIESLDLSYNKFHLNTIPKWVTSSPIIFSLKLAKCGIKMSLDDWKPAQTFYYDFIDLSENEITGSPARFLNQTEYLVEFKAAGNKLRFDMGKLTFAKTLTTLDISRNLVFGKVPAMVAGLKTLNVSHNHLCGKLPVTKFPASAFVGNDCLCGSPLSPCKA


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF510
1-474 PTHR24420:SF510

MNSSFTLFIFTFVIFLQCLNPTGAATCHPDDEAGLLAFKAGITRDPSGILSSWKKGTACCSWNGVTCLTTDRVSALSVAGQADVAGSFLSGTLSPSLAKLKHLDGIYFTDLKNITGSFPQFLFQLPNLKYVYIENNRLSGPLPANIGALSQLEAFSLEGNRFTGPIPSSISNLTRLTQLKLGNNLLTGTIPLGVANLKLMSYLNLGGNRLTGTIPDIFKSMPELRSLTLSRNGFSGNLPPSIASLAPILRFLELGHNKLSGTIPNFLSNFKALDTLDLSKNRFSGVIPKSFANLTKIFNLDLSHNLLTDPFPVLNVKGIESLDLSYNKFHLNTIPKWVTSSPIIFSLKLAKCGIKMSLDDWKPAQTFYYDFIDLSENEITGSPARFLNQTEYLVEFKAAGNKLRFDMGKLTFAKTLTTLDISRNLVFGKVPAMVAGLKTLNVSHNHLCGKLPVTKFPASAFVGNDCLCGSPLSP

HMMPanther: PTHR24420
1-474 PTHR24420,FAMILY NOT NAMED

MNSSFTLFIFTFVIFLQCLNPTGAATCHPDDEAGLLAFKAGITRDPSGILSSWKKGTACCSWNGVTCLTTDRVSALSVAGQADVAGSFLSGTLSPSLAKLKHLDGIYFTDLKNITGSFPQFLFQLPNLKYVYIENNRLSGPLPANIGALSQLEAFSLEGNRFTGPIPSSISNLTRLTQLKLGNNLLTGTIPLGVANLKLMSYLNLGGNRLTGTIPDIFKSMPELRSLTLSRNGFSGNLPPSIASLAPILRFLELGHNKLSGTIPNFLSNFKALDTLDLSKNRFSGVIPKSFANLTKIFNLDLSHNLLTDPFPVLNVKGIESLDLSYNKFHLNTIPKWVTSSPIIFSLKLAKCGIKMSLDDWKPAQTFYYDFIDLSENEITGSPARFLNQTEYLVEFKAAGNKLRFDMGKLTFAKTLTTLDISRNLVFGKVPAMVAGLKTLNVSHNHLCGKLPVTKFPASAFVGNDCLCGSPLSP

superfamily: SSF52058
25-364 SSF52058,LRR

ATCHPDDEAGLLAFKAGITRDPSGILSSWKKGTACCSWNGVTCLTTDRVSALSVAGQADVAGSFLSGTLSPSLAKLKHLDGIYFTDLKNITGSFPQFLFQLPNLKYVYIENNRLSGPLPANIGALSQLEAFSLEGNRFTGPIPSSISNLTRLTQLKLGNNLLTGTIPLGVANLKLMSYLNLGGNRLTGTIPDIFKSMPELRSLTLSRNGFSGNLPPSIASLAPILRFLELGHNKLSGTIPNFLSNFKALDTLDLSKNRFSGVIPKSFANLTKIFNLDLSHNLLTDPFPVLNVKGIESLDLSYNKFHLNTIPKWVTSSPIIFSLKLAKCGIKMSLDDWKPA

Gene3D: G3DSA:3.80.10.10
26-245 G3DSA:3.80.10.10

TCHPDDEAGLLAFKAGITRDPSGILSSWKKGTACCSWNGVTCLTTDRVSALSVAGQADVAGSFLSGTLSPSLAKLKHLDGIYFTDLKNITGSFPQFLFQLPNLKYVYIENNRLSGPLPANIGALSQLEAFSLEGNRFTGPIPSSISNLTRLTQLKLGNNLLTGTIPLGVANLKLMSYLNLGGNRLTGTIPDIFKSMPELRSLTLSRNGFSGNLPPSIASL

HMMPfam: PF08263
IPR013210
29-67 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PDDEAGLLAFKAGITRDPSGILSSWKKGTACCSWNGVTC

HMMPfam: PF00560
IPR001611
202-220 LRR_1
Leucine-rich repeat

YLNLGGNRLTGTIPDIFKS

HMMPfam: PF00560
IPR001611
224-245 LRR_1
Leucine-rich repeat

LRSLTLSRNGFSGNLPPSIASL

Gene3D: G3DSA:3.80.10.10
249-474 G3DSA:3.80.10.10

LRFLELGHNKLSGTIPNFLSNFKALDTLDLSKNRFSGVIPKSFANLTKIFNLDLSHNLLTDPFPVLNVKGIESLDLSYNKFHLNTIPKWVTSSPIIFSLKLAKCGIKMSLDDWKPAQTFYYDFIDLSENEITGSPARFLNQTEYLVEFKAAGNKLRFDMGKLTFAKTLTTLDISRNLVFGKVPAMVAGLKTLNVSHNHLCGKLPVTKFPASAFVGNDCLCGSPLSP

HMMPfam: PF13855
249-307 LRR_8,Leucine rich repeat

LRFLELGHNKLSGTIPNFLSNFKALDTLDLSKNRFSGVIPKSFANLTKIFNLDLSHNLL

superfamily: SSF52058
371-476 SSF52058,LRR

FIDLSENEITGSPARFLNQTEYLVEFKAAGNKLRFDMGKLTFAKTLTTLDISRNLVFGKVPAMVAGLKTLNVSHNHLCGKLPVTKFPASAFVGNDCLCGSPLSPCK

HMMPfam: PF00560
IPR001611
437-456 LRR_1
Leucine-rich repeat

LKTLNVSHNHLCGKLPVTKF


List of References

Brian J Haas, Natalia Volfovsky, Christopher D Town, Maxim Troukhan, Nickolai Alexandrov, Kenneth A Feldmann, Richard B Flavell, Owen White, Steven L Salzberg
Full-length messenger RNA sequences greatly improve genome annotation.
Genome Biol.: 2002, 3(6);RESEARCH0029
PubMed:12093376 WorldCat.org (I p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox