PRGDB00048939 (NDR1)

From PRG Wiki
Jump to: navigation, search
NDR1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 2754815 (AF021346)
Gene Class Unknown
Domain Type
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana non-race specific disease resistance protein (NDR1) gene, complete cds.

DNA Sequence

ATGAATAATCAAAATGAAGACACAGAAGGTGGTCGAAACTGTTGTACTTGCTGCTTAAGCTTCATCTTCACAGCTGGTCTCACCTCTCTTTTCTTATGGCTTAGTCTCCGTGCGGACAAACCCAAATGCTCAATCCAAAACTTTTTCATTCCTGCCCTCGGAAAAGACCCAAATTCACGAGACAATACCACTCTAAATTTCATGGTTCGTTGTGACAATCCGAATAAAGACAAAGGAATCTACTACGACGATGTCCACCTTAATTTTTCCACCATCAACACGACCAAGATCAATTCATCTGCTCTTGTCTTAGTTGGTAACTACACAGTGCCTAAGTTCTATCAAGGACACAAGAAGAAGGCCAAGAAGTGGGGTCAAGTAAAGCCGCTAAACAACCAGACGGTTTTACGAGCGGTTTTGCCTAATGGATCGGCTGTTTTCAGGTTGGATCTCAAGACTCAAGTTAGATTCAAGATTGTTTTTTGGAAAACTAAGAGGTATGGGGTTGAAGTTGGAGCTGATGTTGAAGTCAACGGTGATGGAGTTAAAGCTCAGAAGAAAGGAATTAAGATGAAGAAATCTGATTCTTCTTTTCCATTAAGAAGCTCTTTTCCGATTAGTGTTTTGATGAATTTACTCGTATTCTTTGCTATTCGTTAA


Protein sequences

Name Description Sequence
non-race specific disease resistance protein non-race specific disease resistance protein [Arabidopsis thaliana].

MNNQNEDTEGGRNCCTCCLSFIFTAGLTSLFLWLSLRADKPKCSIQNFFIPALGKDPNSRDNTTLNFMVRCDNPNKDKGIYYDDVHLNFSTINTTKINSSALVLVGNYTVPKFYQGHKKKAKKWGQVKPLNNQTVLRAVLPNGSAVFRLDLKTQVRFKIVFWKTKRYGVEVGADVEVNGDGVKAQKKGIKMKKSDSSFPLRSSFPISVLMNLLVFFAIR



List of References

K S Century, A D Shapiro, P P Repetti, D Dahlbeck, E Holub, B J Staskawicz
NDR1, a pathogen-induced component required for Arabidopsis disease resistance.
Science: 1997, 278(5345);1963-5
PubMed:9395402 WorldCat.org (P p)

Peter Coppinger, Peter P Repetti, Brad Day, Douglas Dahlbeck, Angela Mehlert, Brian J Staskawicz
Overexpression of the plasma membrane-localized NDR1 protein results in enhanced bacterial disease resistance in Arabidopsis thaliana.
Plant J.: 2004, 40(2);225-37
PubMed:15447649 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox