PRGDB00048969 (Pto)

From PRG Wiki
Jump to: navigation, search
Pto
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 70913128 (DQ019190)
Gene Class Unknown
Domain Type Ser-Thr Kinase, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Solanum chilense

Comment?

Lycopersicon chilense clone chi580 Pto disease resistance protein (Pto) gene, partial cds.

DNA Sequence

ACAAATTCCATAAATGATGCTTTAAGCTCGAGTTATCTCGTTCCTTTTGAAAGTTATCGAGTTCCTTTAGTAGATTTGGAGGAAGCAACTAATAATTTTGATCACAAGTTTTTCATTGGACATGGTGTCTTTGGGAAGGTTTACAAGGGTGTTTTGCGTGATGGAACAAAGGTCGCCCTGAAAAGGCGTCAACCTGAGTCCTCACAAGGTATTGAAGAGTTCGAAACAGAGATTGAGACTCTCTCGTTTTGCAGACATCCGCATCTGGTTTCATTGATAGGATTCTGTGGTGAAAGAAATGAGATGATTCTAATTTATAAATACATGGAGAATGGGAACCTCAAAAGCCATTTGTATGGATCAGATCTACCCACTATGAGCATGAGCTGGGAGCAGAGGCTGGAGATATGCATAGGGGCAGCCAGAGGTCTACACTACCTTCATACTAGAGCAGTTATACATCGTGATGTCAAGTCTATAAACATATTGCTTGATGAGAATTTTGTGCCAAAAATTACTGATTTTGGAATATCCAAGAAAGGGACTGAGCTTGATCAAACCCATCTTAGCACAATAGTGAAAGGAACTCTCGGCTACCTTGACCCTGAATATTTTATAAAGGGACGACTCACAGAAAAATCTGATGTTTATTCTTTCGGTGTTGTTTTATTCGAAGTTCTTTGTGCTAGGTCTGCCATAGTTCAATCTCTTCCAAGGGAGATGGTTAATTTAGCTGAATGGGCAGTGGAGTCGCATAATAATGGACAGTTGGAACAAATCGTAGATCCCAATCTTGCAGATAAAATAAGACCAGAGTCCCTCAGGAAGTTTGGAGAAACAGCGGTAAAATGCTTAGCTTTGTCTAGTGAAGATAGGCCATCAATGGGTGATGTGTTGTGGAAACTGGAGTATGCA


Protein sequences

Name Description Sequence
Pto disease resistance protein Pto disease resistance protein [Lycopersicon chilense].

TNSINDALSSSYLVPFESYRVPLVDLEEATNNFDHKFFIGHGVFGKVYKGVLRDGTKVALKRRQPESSQGIEEFETEIETLSFCRHPHLVSLIGFCGERNEMILIYKYMENGNLKSHLYGSDLPTMSMSWEQRLEICIGAARGLHYLHTRAVIHRDVKSINILLDENFVPKITDFGISKKGTELDQTHLSTIVKGTLGYLDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAIVQSLPREMVNLAEWAVESHNNGQLEQIVDPNLADKIRPESLRKFGETAVKCLALSSEDRPSMGDVLWKLEYA

Domains

Domain Start-End Description Sequence

superfamily: SSF56112
IPR011009
5-302 Kinase_like
Protein kinase-like domain

NDALSSSYLVPFESYRVPLVDLEEATNNFDHKFFIGHGVFGKVYKGVLRDGTKVALKRRQPESSQGIEEFETEIETLSFCRHPHLVSLIGFCGERNEMILIYKYMENGNLKSHLYGSDLPTMSMSWEQRLEICIGAARGLHYLHTRAVIHRDVKSINILLDENFVPKITDFGISKKGTELDQTHLSTIVKGTLGYLDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAIVQSLPREMVNLAEWAVESHNNGQLEQIVDPNLADKIRPESLRKFGETAVKCLALSSEDRPSMGDVLWKL

HMMPanther: PTHR24420:SF785
17-305 PTHR24420:SF785

ESYRVPLVDLEEATNNFDHKFFIGHGVFGKVYKGVLRDGTKVALKRRQPESSQGIEEFETEIETLSFCRHPHLVSLIGFCGERNEMILIYKYMENGNLKSHLYGSDLPTMSMSWEQRLEICIGAARGLHYLHTRAVIHRDVKSINILLDENFVPKITDFGISKKGTELDQTHLSTIVKGTLGYLDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAIVQSLPREMVNLAEWAVESHNNGQLEQIVDPNLADKIRPESLRKFGETAVKCLALSSEDRPSMGDVLWKLEYA

HMMPanther: PTHR24420
17-305 PTHR24420,FAMILY NOT NAMED

ESYRVPLVDLEEATNNFDHKFFIGHGVFGKVYKGVLRDGTKVALKRRQPESSQGIEEFETEIETLSFCRHPHLVSLIGFCGERNEMILIYKYMENGNLKSHLYGSDLPTMSMSWEQRLEICIGAARGLHYLHTRAVIHRDVKSINILLDENFVPKITDFGISKKGTELDQTHLSTIVKGTLGYLDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAIVQSLPREMVNLAEWAVESHNNGQLEQIVDPNLADKIRPESLRKFGETAVKCLALSSEDRPSMGDVLWKLEYA

Gene3D: G3DSA:3.30.200.20
21-109 G3DSA:3.30.200.20

VPLVDLEEATNNFDHKFFIGHGVFGKVYKGVLRDGTKVALKRRQPESSQGIEEFETEIETLSFCRHPHLVSLIGFCGERNEMILIYKYM

ProfileScan: PS50011
IPR000719
33-305 PROTEIN_KINASE_DOM
Protein kinase, catalytic domain

FDHKFFIGHGVFGKVYKGVLRDGTKVALKRRQPESSQGIEEFETEIETLSFCRHPHLVSLIGFCGERNEMILIYKYMENGNLKSHLYGSDLPTMSMSWEQRLEICIGAARGLHYLHTRAVIHRDVKSINILLDENFVPKITDFGISKKGTELDQTHLSTIVKGTLGYLDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAIVQSLPREMVNLAEWAVESHNNGQLEQIVDPNLADKIRPESLRKFGETAVKCLALSSEDRPSMGDVLWKLEYA

PatternScan: PS00107
IPR017441
39-61 PROTEIN_KINASE_ATP
Protein kinase, ATP binding site

IGHGVFGKVYKGVLRDGTKVALK

HMMPfam: PF07714
IPR001245
39-299 Pkinase_Tyr
Serine-threonine/tyrosine-protein kinase catalytic

IGHGVFGKVYKGVLRDGTKVALKRRQPESSQGIEEFETEIETLSFCRHPHLVSLIGFCGERNEMILIYKYMENGNLKSHLYGSDLPTMSMSWEQRLEICIGAARGLHYLHTRAVIHRDVKSINILLDENFVPKITDFGISKKGTELDQTHLSTIVKGTLGYLDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAIVQSLPREMVNLAEWAVESHNNGQLEQIVDPNLADKIRPESLRKFGETAVKCLALSSEDRPSMGDVL

Gene3D: G3DSA:1.10.510.10
111-300 G3DSA:1.10.510.10

NGNLKSHLYGSDLPTMSMSWEQRLEICIGAARGLHYLHTRAVIHRDVKSINILLDENFVPKITDFGISKKGTELDQTHLSTIVKGTLGYLDPEYFIKGRLTEKSDVYSFGVVLFEVLCARSAIVQSLPREMVNLAEWAVESHNNGQLEQIVDPNLADKIRPESLRKFGETAVKCLALSSEDRPSMGDVLW

PatternScan: PS00108
IPR008271
152-164 PROTEIN_KINASE_ST
Serine/threonine-protein kinase, active site

VIHRDVKSINILL


List of References

Laura E Rose, Charles H Langley, Adriana J Bernal, Richard W Michelmore
Natural variation in the Pto pathogen resistance gene within species of wild tomato (Lycopersicon). I. Functional analysis of Pto alleles.
Genetics: 2005, 171(1);345-57
PubMed:15944360 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox