PRGDB00048989 (rxo1)

From PRG Wiki
Jump to: navigation, search
rxo1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 60615303 (AY935244)
Gene Class NL
Domain Type LRR, NBS, LRR, LRR, Others
Gene Species Zea mays

Comment?

Zea mays RXO1 disease resistance protein (rxo1) gene, complete cds.

DNA Sequence

ATGGCAGAGATTGCTGTTCTTCTCGTCCTGAAGAAGATTGCCATAGCTCTGGCAGGAGAGACCCTAAGTTTTGCTAAACCATTGCTTGCAAAGAAGTCTGAGTCGGTGGCAGCACTCCCAGATGACATGAAACTGATTAGTAATGAGCTCGAGCTTATCCGGGCGTTTCTCAAGGAAATCGGCAGGAAAGGCTGGAAAAGCGAAGTGATAGAAACATGGATAGGGCAGGTCCGAAGACTGGCTTATGATATGGAAGACACTGTAGACCATTTTATTTACGTTGTTGGTACACACGATCAGATGGGATCATGCTGGGATTACATGAAGAAGATAGCCAAGAAGCCTCGGCGTCTGGTTTCACTAGATGAAATTGCTAGTGAGATTAAGAAGATAAAGCAAGAGCTTAAACAACTCTCGGAAAGTAGAGACCGCTGGACTAAACCCTTGGATGGCGGGAGTGGTATACCTGCAGGAAGCTATGAAACTGAAAAGGAAATGTATCTTCCTGGACATGATTACACAATCAGCGACGAGGAGCTTGCAGGAATTGATGAAAATAAGCAAACCTTGATTAGTTCATTAAAATTTGAAGATCCATCACTTCGGATCATTGCTGTCTGGGGTATGGGTGGCGTTGGAAAAAGCACTCTTGTAAATAATGTGTACAAAAATGAAGGATCCAACTTTGACTGCCGTGCATGGGTTTCTATCTCTCAGTCATATAGACTAGAAGATATATGGAAGAAAATGCTGACAGATCTCATCGGGAAAGATAAGATAGAATTTGATCTTGGAACAATGGATAGTGCAGAACTAAGAGAGCAATTGACAAAAACTCTAGACAAAAGGCAGTACCTGATCATACTGGATGATGTCTGGATGGCTAATGTTTTTTTTAAAATTAAAGAAGTTCTTGTAGATAATGGCCTTGGAAGCAGAGTAATAATCACAACAAGAATTGAGGAGGTAGCTTCACTAGCTAAGGGTAGTTGTAAGATCAAAGTAGAACCTCTGGGTGTCGATGATTCCTGGCATGTATTTTGTAGGAAGGCATTTCTGAAAGATGAAAACCATATCTGCCCTCCAGAGTTGCGTCAGTGTGGTATAAACATTGTGGAGAAATGTGATGGTTTGCCATTAGCCCTTGTGGCAATAGGAAGCATATTGTCGCTGAGACCGAAGAATGTTGACGAGTGGAAGCTATTTTATGACCAGCTTATCTGGGAGCTACACAACAATGAGAACCTTAATCGCGTGGAGAAAATTATGAATCTAAGTTATAAATACTTACCAGACTATTTGAAGAACTGCTTCCTGTATTGTGCTATGTTTCCAGAAGACTATCTAATACACAGAAAGAGATTGATTAGATTGTGGATAGCTGAAGGATTTATTGAACAAAAAGGGGCATGCAGCTTAGAAGACACTGCTGAAAGTTATCTTAAAGAACTTATACGACGGAGCATGCTTCACGTTGCAGAGAGGAACTGCTTTGGTAGGATTAAATGTATTCGAATGCATGATCTTGTGCGTGAACTTGCCATTTTCCAATCTAAAAGAGAGGGTTTCAGTACAACTTATGGTGGAAATAATGAAGCAGTGCTAGTGGGATCATATTCTCGACGAGTGGCTGTGCTCCAATGCAGCAAGGGCATTCCATCAACCATTGATCCATCCAGGCTTCGCACCTTAATTACATTCGACACCAGCAGAGCATTATCTGTGTGGTATTCTTCTATTTCCTCCAAACCAAAGTACCTTGCAGTATTAGACTTATCAAGCTTGCCTATTGAGACTATTCCAAATTCAATTGGAGAGCTTTTCAACCTTAGGCTTTTATGCCTCAATAAAACCAAAGTGAAAGAGCTCCCTAAATCTATTACAAAACTTCAAAACCTACAGACAATGAGTCTTGAGAATGGGGAGTTAGTGAAGTTCCCACAAGGGTTTTCAAAACTGAAGAAATTGCGACATCTTATGGTTTCACGGTTGCAAGATGTAACTTTCAGCGGTTTCAAAAGTTGGGAAGCTGTGGAGCCATTTAAGGGCTTGTGGACTTTGATTGAACTGCAAACTCTGTATGCCATTACAGCAAGTGAAGTATTAGTTGCAAAACTTGGAAATTTATCCCAGCTGAGGCGGCTTATAATTTGTGATGTAAGGAGTAACTTATGTGCACAGTTGTGTGGCTCTTTGTCAAAGTTGTGCCAGCTGTCACGATTAACGATAAGAGCATGCAATGAAGATGAAGTGCTACAGCTGGATCATTTGACATTTCCAAATCCTCTTCAAACCCTTAGTTTAGATGGACGACTGTCAGAAGGAACTTTCAAATCTCCCTTTTTCTTAAATCATGGAAATGGGCTTCTTAGGCTAATGTTGTTTTACAGTCAGCTTTCAGAAAATCCAGTACCACACCTCTCTGAATTGTCAAACTTGACTAGGTTATCCCTTATAAAGGCATACACCGGCCAAGAATTATACTTCCAAGCAGGTTGGTTCCTGAATTTAAAAGAACTTTACTTGAAGAATTTGTCCCGGCTCAATCAAATAGACATACAGGAGGGAGCTTTGGCCAGCCTTGAACGTATAACAATGAAACACCTCCCGGAGCTACGGGAGGTTCCAGTCGGTTTCAGATTTCTCAAGTCCCTAAAAACAATATTTTTTTCCGATATGCATCCTGAGTTTGAAAGCAGCTTTCAAAAGGAAATGTAG


Protein sequences

Name Description Sequence
RXO1 disease resistance protein RXO1 disease resistance protein [Zea mays].

MAEIAVLLVLKKIAIALAGETLSFAKPLLAKKSESVAALPDDMKLISNELELIRAFLKEIGRKGWKSEVIETWIGQVRRLAYDMEDTVDHFIYVVGTHDQMGSCWDYMKKIAKKPRRLVSLDEIASEIKKIKQELKQLSESRDRWTKPLDGGSGIPAGSYETEKEMYLPGHDYTISDEELAGIDENKQTLISSLKFEDPSLRIIAVWGMGGVGKSTLVNNVYKNEGSNFDCRAWVSISQSYRLEDIWKKMLTDLIGKDKIEFDLGTMDSAELREQLTKTLDKRQYLIILDDVWMANVFFKIKEVLVDNGLGSRVIITTRIEEVASLAKGSCKIKVEPLGVDDSWHVFCRKAFLKDENHICPPELRQCGINIVEKCDGLPLALVAIGSILSLRPKNVDEWKLFYDQLIWELHNNENLNRVEKIMNLSYKYLPDYLKNCFLYCAMFPEDYLIHRKRLIRLWIAEGFIEQKGACSLEDTAESYLKELIRRSMLHVAERNCFGRIKCIRMHDLVRELAIFQSKREGFSTTYGGNNEAVLVGSYSRRVAVLQCSKGIPSTIDPSRLRTLITFDTSRALSVWYSSISSKPKYLAVLDLSSLPIETIPNSIGELFNLRLLCLNKTKVKELPKSITKLQNLQTMSLENGELVKFPQGFSKLKKLRHLMVSRLQDVTFSGFKSWEAVEPFKGLWTLIELQTLYAITASEVLVAKLGNLSQLRRLIICDVRSNLCAQLCGSLSKLCQLSRLTIRACNEDEVLQLDHLTFPNPLQTLSLDGRLSEGTFKSPFFLNHGNGLLRLMLFYSQLSENPVPHLSELSNLTRLSLIKAYTGQELYFQAGWFLNLKELYLKNLSRLNQIDIQEGALASLERITMKHLPELREVPVGFRFLKSLKTIFFSDMHPEFESSFQKEM

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155
14-894 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

AIALAGETLSFAKPLLAKKSESVAALPDDMKLISNELELIRAFLKEIGRKGWKSEVIETWIGQVRRLAYDMEDTVDHFIYVVGTHDQMGSCWDYMKKIAKKPRRLVSLDEIASEIKKIKQELKQLSESRDRWTKPLDGGSGIPAGSYETEKEMYLPGHDYTISDEELAGIDENKQTLISSLKFEDPSLRIIAVWGMGGVGKSTLVNNVYKNEGSNFDCRAWVSISQSYRLEDIWKKMLTDLIGKDKIEFDLGTMDSAELREQLTKTLDKRQYLIILDDVWMANVFFKIKEVLVDNGLGSRVIITTRIEEVASLAKGSCKIKVEPLGVDDSWHVFCRKAFLKDENHICPPELRQCGINIVEKCDGLPLALVAIGSILSLRPKNVDEWKLFYDQLIWELHNNENLNRVEKIMNLSYKYLPDYLKNCFLYCAMFPEDYLIHRKRLIRLWIAEGFIEQKGACSLEDTAESYLKELIRRSMLHVAERNCFGRIKCIRMHDLVRELAIFQSKREGFSTTYGGNNEAVLVGSYSRRVAVLQCSKGIPSTIDPSRLRTLITFDTSRALSVWYSSISSKPKYLAVLDLSSLPIETIPNSIGELFNLRLLCLNKTKVKELPKSITKLQNLQTMSLENGELVKFPQGFSKLKKLRHLMVSRLQDVTFSGFKSWEAVEPFKGLWTLIELQTLYAITASEVLVAKLGNLSQLRRLIICDVRSNLCAQLCGSLSKLCQLSRLTIRACNEDEVLQLDHLTFPNPLQTLSLDGRLSEGTFKSPFFLNHGNGLLRLMLFYSQLSENPVPHLSELSNLTRLSLIKAYTGQELYFQAGWFLNLKELYLKNLSRLNQIDIQEGALASLERITMKHLPELREVPVGFRFLKSLKTIFFSDMH

HMMPanther: PTHR23155:SF186
14-894 PTHR23155:SF186,OS09G0479500 PROTEIN

AIALAGETLSFAKPLLAKKSESVAALPDDMKLISNELELIRAFLKEIGRKGWKSEVIETWIGQVRRLAYDMEDTVDHFIYVVGTHDQMGSCWDYMKKIAKKPRRLVSLDEIASEIKKIKQELKQLSESRDRWTKPLDGGSGIPAGSYETEKEMYLPGHDYTISDEELAGIDENKQTLISSLKFEDPSLRIIAVWGMGGVGKSTLVNNVYKNEGSNFDCRAWVSISQSYRLEDIWKKMLTDLIGKDKIEFDLGTMDSAELREQLTKTLDKRQYLIILDDVWMANVFFKIKEVLVDNGLGSRVIITTRIEEVASLAKGSCKIKVEPLGVDDSWHVFCRKAFLKDENHICPPELRQCGINIVEKCDGLPLALVAIGSILSLRPKNVDEWKLFYDQLIWELHNNENLNRVEKIMNLSYKYLPDYLKNCFLYCAMFPEDYLIHRKRLIRLWIAEGFIEQKGACSLEDTAESYLKELIRRSMLHVAERNCFGRIKCIRMHDLVRELAIFQSKREGFSTTYGGNNEAVLVGSYSRRVAVLQCSKGIPSTIDPSRLRTLITFDTSRALSVWYSSISSKPKYLAVLDLSSLPIETIPNSIGELFNLRLLCLNKTKVKELPKSITKLQNLQTMSLENGELVKFPQGFSKLKKLRHLMVSRLQDVTFSGFKSWEAVEPFKGLWTLIELQTLYAITASEVLVAKLGNLSQLRRLIICDVRSNLCAQLCGSLSKLCQLSRLTIRACNEDEVLQLDHLTFPNPLQTLSLDGRLSEGTFKSPFFLNHGNGLLRLMLFYSQLSENPVPHLSELSNLTRLSLIKAYTGQELYFQAGWFLNLKELYLKNLSRLNQIDIQEGALASLERITMKHLPELREVPVGFRFLKSLKTIFFSDMH

superfamily: SSF52540
155-413 SSF52540

IPAGSYETEKEMYLPGHDYTISDEELAGIDENKQTLISSLKFEDPSLRIIAVWGMGGVGKSTLVNNVYKNEGSNFDCRAWVSISQSYRLEDIWKKMLTDLIGKDKIEFDLGTMDSAELREQLTKTLDKRQYLIILDDVWMANVFFKIKEVLVDNGLGSRVIITTRIEEVASLAKGSCKIKVEPLGVDDSWHVFCRKAFLKDENHICPPELRQCGINIVEKCDGLPLALVAIGSILSLRPKNVDEWKLFYDQLIWELHNN

Gene3D: G3DSA:3.40.50.300
175-295 G3DSA:3.40.50.300

ISDEELAGIDENKQTLISSLKFEDPSLRIIAVWGMGGVGKSTLVNNVYKNEGSNFDCRAWVSISQSYRLEDIWKKMLTDLIGKDKIEFDLGTMDSAELREQLTKTLDKRQYLIILDDVWMA

HMMPfam: PF00931
IPR002182
185-467 NB-ARC,NBS
NB-ARC

ENKQTLISSLKFEDPSLRIIAVWGMGGVGKSTLVNNVYKNEGSNFDCRAWVSISQSYRLEDIWKKMLTDLIGKDKIEFDLGTMDSAELREQLTKTLDKRQYLIILDDVWMANVFFKIKEVLVDNGLGSRVIITTRIEEVASLAKGSCKIKVEPLGVDDSWHVFCRKAFLKDENHICPPELRQCGINIVEKCDGLPLALVAIGSILSLRPKNVDEWKLFYDQLIWELHNNENLNRVEKIMNLSYKYLPDYLKNCFLYCAMFPEDYLIHRKRLIRLWIAEGFIEQ

FPrintScan: PR00364
IPR000767
203-218 DISEASERSIST
Disease resistance protein

IIAVWGMGGVGKSTLV

FPrintScan: PR00364
IPR000767
279-293 DISEASERSIST
Disease resistance protein

TLDKRQYLIILDDVW

FPrintScan: PR00364
IPR000767
375-389 DISEASERSIST
Disease resistance protein

CDGLPLALVAIGSIL

superfamily: SSF52058
505-894 SSF52058,LRR

RMHDLVRELAIFQSKREGFSTTYGGNNEAVLVGSYSRRVAVLQCSKGIPSTIDPSRLRTLITFDTSRALSVWYSSISSKPKYLAVLDLSSLPIETIPNSIGELFNLRLLCLNKTKVKELPKSITKLQNLQTMSLENGELVKFPQGFSKLKKLRHLMVSRLQDVTFSGFKSWEAVEPFKGLWTLIELQTLYAITASEVLVAKLGNLSQLRRLIICDVRSNLCAQLCGSLSKLCQLSRLTIRACNEDEVLQLDHLTFPNPLQTLSLDGRLSEGTFKSPFFLNHGNGLLRLMLFYSQLSENPVPHLSELSNLTRLSLIKAYTGQELYFQAGWFLNLKELYLKNLSRLNQIDIQEGALASLERITMKHLPELREVPVGFRFLKSLKTIFFSDMH

Gene3D: G3DSA:3.80.10.10
582-665 G3DSA:3.80.10.10

SKPKYLAVLDLSSLPIETIPNSIGELFNLRLLCLNKTKVKELPKSITKLQNLQTMSLENGELVKFPQGFSKLKKLRHLMVSRLQ

FPrintScan: PR00364
IPR000767
628-644 DISEASERSIST
Disease resistance protein

TKLQNLQTMSLENGELV

Gene3D: G3DSA:3.80.10.10
674-891 G3DSA:3.80.10.10

SWEAVEPFKGLWTLIELQTLYAITASEVLVAKLGNLSQLRRLIICDVRSNLCAQLCGSLSKLCQLSRLTIRACNEDEVLQLDHLTFPNPLQTLSLDGRLSEGTFKSPFFLNHGNGLLRLMLFYSQLSENPVPHLSELSNLTRLSLIKAYTGQELYFQAGWFLNLKELYLKNLSRLNQIDIQEGALASLERITMKHLPELREVPVGFRFLKSLKTIFFS


List of References

Bingyu Zhao, Xinghua Lin, Jesse Poland, Harold Trick, Jan Leach, Scot Hulbert
A maize resistance gene functions against bacterial streak disease in rice.
Proc. Natl. Acad. Sci. U.S.A.: 2005, 102(43);15383-8
PubMed:16230639 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox