PRGDB00049000 (cf-2/CF-5)

From PRG Wiki
Jump to: navigation, search
cf-2/CF-5
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 74381973 (AM085131)
Gene Class Unknown
Domain Type LRR, Ser-Thr Kinase
Gene Species Musa acuminata subsp. errans

Comment?

Musa sp. L204 partial cf-2/CF-5 gene for putative Cf2/Cf5-like disease resistance protein, clone L204.

DNA Sequence

AATTCTCTTGGAGGTGTTATTTCAGAAGTTCATTTTGAGAATCTTACGAGATTGCAAGTGTTGGACTTGTCTGACAACCCCATCACCATATCAATTGGCCAGAGTTGGGTTCCCCCTTTCCAACTCAGATATGTATATTTAACGAATTGTCAGTTGGGACCTCAATTTCCAGATTGGTTGCAGTTCCAAACACAGATCCAAGAATTATATTTGGCAGACTGTAAACTTGCAGGGACAATGCCCGCTTGGTTTTGGAATATTTCATCTTCTACCATCATATTTTTAGACCTTTCCAACAACCAAATAGAAGGGAAGCTGCCATCTTCTTTAAAGTTCACCAAGTTGGTTATATTATATTTGGATTCCAATAGATTTGAAGGTCCATTGCCTACGATGCTACCGTCTACGCTTGATACTCTATACCTCTTCAATAATTCCTTTACTGGGCAATTGCCGATATGGCCCCATGTTCACTCGGTGGCGCTCTCAGACAACCTGCTTGATGGTGGCTTATCTTCATCAATCTGCCAATGGACATATCTCGAATACCTTGATCTTTCAGACAACAAATTACTTGGTGAGATCCCTCATTGTTTAGGGGAGTCATTACAAAATATTTATTTCTTAAATTTGGACAACAACCGCTTGTCGGGTGAAATTCCACACACGATCGGTTTTTTAAGTAAGCTTATGCTATTGCAACTGAAAAATAATAGTTTTTCGGGTGAGATTCCTTTGTCATTGAAATATTGTACAAATTTATGGTTTCTTGATCTGGCTCAAAATAATCTTGTCGGAAGTATAACGCTATGGATGGGAGAAAATCTACAACAACTGCTAGTACTTCATCTACGTTCAAAT


Protein sequences

Name Description Sequence
putative Cf2/Cf5-like disease resistance protein putative Cf2/Cf5-like disease resistance protein [Musa acuminata subsp. errans].

NSLGGVISEVHFENLTRLQVLDLSDNPITISIGQSWVPPFQLRYVYLTNCQLGPQFPDWLQFQTQIQELYLADCKLAGTMPAWFWNISSSTIIFLDLSNNQIEGKLPSSLKFTKLVILYLDSNRFEGPLPTMLPSTLDTLYLFNNSFTGQLPIWPHVHSVALSDNLLDGGLSSSICQWTYLEYLDLSDNKLLGEIPHCLGESLQNIYFLNLDNNRLSGEIPHTIGFLSKLMLLQLKNNSFSGEIPLSLKYCTNLWFLDLAQNNLVGSITLWMGENLQQLLVLHLRSN


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF474
1-268 PTHR24420:SF474,SUBFAMILY NOT NAMED

NSLGGVISEVHFENLTRLQVLDLSDNPITISIGQSWVPPFQLRYVYLTNCQLGPQFPDWLQFQTQIQELYLADCKLAGTMPAWFWNISSSTIIFLDLSNNQIEGKLPSSLKFTKLVILYLDSNRFEGPLPTMLPSTLDTLYLFNNSFTGQLPIWPHVHSVALSDNLLDGGLSSSICQWTYLEYLDLSDNKLLGEIPHCLGESLQNIYFLNLDNNRLSGEIPHTIGFLSKLMLLQLKNNSFSGEIPLSLKYCTNLWFLDLAQNNLVGSI

HMMPanther: PTHR24420
1-268 PTHR24420,FAMILY NOT NAMED

NSLGGVISEVHFENLTRLQVLDLSDNPITISIGQSWVPPFQLRYVYLTNCQLGPQFPDWLQFQTQIQELYLADCKLAGTMPAWFWNISSSTIIFLDLSNNQIEGKLPSSLKFTKLVILYLDSNRFEGPLPTMLPSTLDTLYLFNNSFTGQLPIWPHVHSVALSDNLLDGGLSSSICQWTYLEYLDLSDNKLLGEIPHCLGESLQNIYFLNLDNNRLSGEIPHTIGFLSKLMLLQLKNNSFSGEIPLSLKYCTNLWFLDLAQNNLVGSI

superfamily: SSF52047
6-287 SSF52047,LRR

VISEVHFENLTRLQVLDLSDNPITISIGQSWVPPFQLRYVYLTNCQLGPQFPDWLQFQTQIQELYLADCKLAGTMPAWFWNISSSTIIFLDLSNNQIEGKLPSSLKFTKLVILYLDSNRFEGPLPTMLPSTLDTLYLFNNSFTGQLPIWPHVHSVALSDNLLDGGLSSSICQWTYLEYLDLSDNKLLGEIPHCLGESLQNIYFLNLDNNRLSGEIPHTIGFLSKLMLLQLKNNSFSGEIPLSLKYCTNLWFLDLAQNNLVGSITLWMGENLQQLLVLHLRSN

Gene3D: G3DSA:3.80.10.10
8-150 G3DSA:3.80.10.10

SEVHFENLTRLQVLDLSDNPITISIGQSWVPPFQLRYVYLTNCQLGPQFPDWLQFQTQIQELYLADCKLAGTMPAWFWNISSSTIIFLDLSNNQIEGKLPSSLKFTKLVILYLDSNRFEGPLPTMLPSTLDTLYLFNNSFTGQ

HMMPfam: PF00560
IPR001611
17-34 LRR_1
Leucine-rich repeat

RLQVLDLSDNPITISIGQ

HMMPfam: PF00560
IPR001611
93-111 LRR_1
Leucine-rich repeat

IFLDLSNNQIEGKLPSSLK

Gene3D: G3DSA:3.80.10.10
155-287 G3DSA:3.80.10.10

PHVHSVALSDNLLDGGLSSSICQWTYLEYLDLSDNKLLGEIPHCLGESLQNIYFLNLDNNRLSGEIPHTIGFLSKLMLLQLKNNSFSGEIPLSLKYCTNLWFLDLAQNNLVGSITLWMGENLQQLLVLHLRSN

HMMPfam: PF00560
IPR001611
181-198 LRR_1
Leucine-rich repeat

LEYLDLSDNKLLGEIPHC

HMMPfam: PF00560
IPR001611
207-224 LRR_1
Leucine-rich repeat

YFLNLDNNRLSGEIPHTI

HMMPfam: PF13504
252-265 LRR_7,Leucine rich repeat

TNLWFLDLAQNNLV






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox