PRGDB00049001 (cf-2/CF-5)

From PRG Wiki
Jump to: navigation, search
cf-2/CF-5
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 74381971 (AM085130)
Gene Class Unknown
Domain Type LRR, Ser-Thr Kinase
Gene Species Musa acuminata subsp. errans

Comment?

Musa sp. L62 partial cf-2/CF-5 gene for putative Cf2/Cf5-like disease resistance protein, clone L62.

DNA Sequence

AATTCTCTTGCAGGTGTTATTTCAGAGGTTCATTTTGAGAATCTTACGAGATTGCAAGTGTTGGACTTGTCTTACAACCCCATCACCATATCAATTGGACAGAGTTGGATCCCCCCTTTCCAACTCAGATATGTAGATTTAACCAAATGTCAGTTGGGACCTCAATTTCCAGAATGGTTACAGTTCCAAACACAGATCGAAGAATTATATTTGGCAGACTGTAAAGTTGCAGGGACAATGCCCGCTTGGTTTTGGAATATTTCATCTTCTACCATCACAGATTTAGACCTTTCCAACAACCAAATAGGAGGGAAGCTGCCATCTTCTTTAAAGTTCACCAAGTTGGAAAGATTACATTTGGAATCCAACAGATTTGAAGGTCCATTGCCAACGATGCTACCGTCTACACTTGAAACTATATACCTCTCCAATAATTCCTTTGGAGGGCAATTGCCGATATGGCCTCATGTTAGATCAGTGGGACTCTCAGATAACATGCTTGACGGTGGCTTATCTTCGTCAATCTGCCAATGGACAGGTGGTCTCGAATACCTCGACCTTTCGAACAACAAATTACTTGGTGAGATCCCTCATTATTGTTTGGGAAAGTCATTCCAAAATCTTTATTTCTTAAATTTGGGCAACAATCGCTTGTCGGGTGAAATTCCTCACACGATCGGTTTTTTAAGTGAGCTTATGTTATTGCAACTGGAAAATAACAGTTTTTCAGGTGAGGTTCCTTTGTCATTAAAATATTGTGCAAATTTATGGTATCTTGATCTGGCCCAAAATAATCTTATCGGAAGTATAACGCTATTCATGGGAGAAAATTTACAACAACTGCTAGTACTTCATCTACGTTCAAAT


Protein sequences

Name Description Sequence
putative Cf2/Cf5-like disease resistance protein putative Cf2/Cf5-like disease resistance protein [Musa acuminata subsp. errans].

NSLAGVISEVHFENLTRLQVLDLSYNPITISIGQSWIPPFQLRYVDLTKCQLGPQFPEWLQFQTQIEELYLADCKVAGTMPAWFWNISSSTITDLDLSNNQIGGKLPSSLKFTKLERLHLESNRFEGPLPTMLPSTLETIYLSNNSFGGQLPIWPHVRSVGLSDNMLDGGLSSSICQWTGGLEYLDLSNNKLLGEIPHYCLGKSFQNLYFLNLGNNRLSGEIPHTIGFLSELMLLQLENNSFSGEVPLSLKYCANLWYLDLAQNNLIGSITLFMGENLQQLLVLHLRSN


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF474
1-270 PTHR24420:SF474,SUBFAMILY NOT NAMED

NSLAGVISEVHFENLTRLQVLDLSYNPITISIGQSWIPPFQLRYVDLTKCQLGPQFPEWLQFQTQIEELYLADCKVAGTMPAWFWNISSSTITDLDLSNNQIGGKLPSSLKFTKLERLHLESNRFEGPLPTMLPSTLETIYLSNNSFGGQLPIWPHVRSVGLSDNMLDGGLSSSICQWTGGLEYLDLSNNKLLGEIPHYCLGKSFQNLYFLNLGNNRLSGEIPHTIGFLSELMLLQLENNSFSGEVPLSLKYCANLWYLDLAQNNLIGSI

Gene3D: G3DSA:3.80.10.10
1-186 G3DSA:3.80.10.10

NSLAGVISEVHFENLTRLQVLDLSYNPITISIGQSWIPPFQLRYVDLTKCQLGPQFPEWLQFQTQIEELYLADCKVAGTMPAWFWNISSSTITDLDLSNNQIGGKLPSSLKFTKLERLHLESNRFEGPLPTMLPSTLETIYLSNNSFGGQLPIWPHVRSVGLSDNMLDGGLSSSICQWTGGLEYLD

HMMPanther: PTHR24420
1-270 PTHR24420,FAMILY NOT NAMED

NSLAGVISEVHFENLTRLQVLDLSYNPITISIGQSWIPPFQLRYVDLTKCQLGPQFPEWLQFQTQIEELYLADCKVAGTMPAWFWNISSSTITDLDLSNNQIGGKLPSSLKFTKLERLHLESNRFEGPLPTMLPSTLETIYLSNNSFGGQLPIWPHVRSVGLSDNMLDGGLSSSICQWTGGLEYLDLSNNKLLGEIPHYCLGKSFQNLYFLNLGNNRLSGEIPHTIGFLSELMLLQLENNSFSGEVPLSLKYCANLWYLDLAQNNLIGSI

superfamily: SSF52047
7-286 SSF52047,LRR

ISEVHFENLTRLQVLDLSYNPITISIGQSWIPPFQLRYVDLTKCQLGPQFPEWLQFQTQIEELYLADCKVAGTMPAWFWNISSSTITDLDLSNNQIGGKLPSSLKFTKLERLHLESNRFEGPLPTMLPSTLETIYLSNNSFGGQLPIWPHVRSVGLSDNMLDGGLSSSICQWTGGLEYLDLSNNKLLGEIPHYCLGKSFQNLYFLNLGNNRLSGEIPHTIGFLSELMLLQLENNSFSGEVPLSLKYCANLWYLDLAQNNLIGSITLFMGENLQQLLVLHL

HMMPfam: PF00560
IPR001611
17-39 LRR_1
Leucine-rich repeat

RLQVLDLSYNPITISIGQSWIPP

HMMPfam: PF13516
90-110 LRR_6,Leucine Rich repeat

STITDLDLSNNQIGGKLPSSL

HMMPfam: PF00560
IPR001611
182-201 LRR_1
Leucine-rich repeat

LEYLDLSNNKLLGEIPHYCL

Gene3D: G3DSA:3.80.10.10
187-289 G3DSA:3.80.10.10

LSNNKLLGEIPHYCLGKSFQNLYFLNLGNNRLSGEIPHTIGFLSELMLLQLENNSFSGEVPLSLKYCANLWYLDLAQNNLIGSITLFMGENLQQLLVLHLRSN

HMMPfam: PF00560
IPR001611
207-226 LRR_1
Leucine-rich repeat

NLYFLNLGNNRLSGEIPHTI






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox