PRGDB00049003 (putative NBS-LRR type disease resistance protein)

From PRG Wiki
Jump to: navigation, search
putative NBS-LRR type disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 71534887 (DQ122770)
Gene Class NL
Domain Type NBS, LRR
Gene Species Medicago sativa

Comment?

Medicago sativa clone K5 putative NBS-LRR type disease resistance protein mRNA, partial cds.

DNA Sequence

GTACTTGGTTTTATTTGATGATGTTTGGAAAGAAAATTTTTCTGATGAGATTAAACATGCCTTAATTAGTAATAACAAAGGAAGTAGAATCATCGTGACCACTAGAAATATGAAAGTAGCAGAATATTTTAAGACAGATTTTCCTGTTCATATTCATGAGCTACAACCTTTGTCTTCAGAGAAAGCATGGGAACTGTTTTGTAATAAGGCATTTATATTTGAGCCTGGAAAACAGTGTCCAATAGTCCTTGCGGACATGTCCAATGAAATTGTTCAAAAATGTGGAGGGCTACCACTGGCTATTGTCGCCATTGGTGGTCTTTTGTCAACAAAGCCTAAAAACATTTTTGAGTGGGAAAAGGTGAGTAGAAATCTGAGAATGGAGTTAGAGCGCAATGTGCACTTGACTAGTCTAATAAGAATTTTATCTCTTAGTTATGATGATTTGCCTTACCATTTGAAATCATGCATGCTATATTTTGGTATATATCCTGAGGACTACTCCATCAATCGGAAGAGACTTACTCGGCAATGGATGGCAGAAGGGTTTGTTAAGAATGGGGAGACAAGACCATTGGA


Protein sequences

Name Description Sequence
putative NBS-LRR type disease resistance protein putative NBS-LRR type disease resistance protein [Medicago sativa].

YLVLFDDVWKENFSDEIKHALISNNKGSRIIVTTRNMKVAEYFKTDFPVHIHELQPLSSEKAWELFCNKAFIFEPGKQCPIVLADMSNEIVQKCGGLPLAIVAIGGLLSTKPKNIFEWEKVSRNLRMELERNVHLTSLIRILSLSYDDLPYHLKSCMLYFGIYPEDYSINRKRLTRQWMAEGFVKNGETRPL


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF129
1-188 PTHR11017:SF129

YLVLFDDVWKENFSDEIKHALISNNKGSRIIVTTRNMKVAEYFKTDFPVHIHELQPLSSEKAWELFCNKAFIFEPGKQCPIVLADMSNEIVQKCGGLPLAIVAIGGLLSTKPKNIFEWEKVSRNLRMELERNVHLTSLIRILSLSYDDLPYHLKSCMLYFGIYPEDYSINRKRLTRQWMAEGFVKNGE

superfamily: SSF52540
1-133 SSF52540

YLVLFDDVWKENFSDEIKHALISNNKGSRIIVTTRNMKVAEYFKTDFPVHIHELQPLSSEKAWELFCNKAFIFEPGKQCPIVLADMSNEIVQKCGGLPLAIVAIGGLLSTKPKNIFEWEKVSRNLRMELERNV

HMMPfam: PF00931
IPR002182
1-186 NB-ARC,NBS
NB-ARC

YLVLFDDVWKENFSDEIKHALISNNKGSRIIVTTRNMKVAEYFKTDFPVHIHELQPLSSEKAWELFCNKAFIFEPGKQCPIVLADMSNEIVQKCGGLPLAIVAIGGLLSTKPKNIFEWEKVSRNLRMELERNVHLTSLIRILSLSYDDLPYHLKSCMLYFGIYPEDYSINRKRLTRQWMAEGFVKN

HMMPanther: PTHR11017
1-188 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

YLVLFDDVWKENFSDEIKHALISNNKGSRIIVTTRNMKVAEYFKTDFPVHIHELQPLSSEKAWELFCNKAFIFEPGKQCPIVLADMSNEIVQKCGGLPLAIVAIGGLLSTKPKNIFEWEKVSRNLRMELERNVHLTSLIRILSLSYDDLPYHLKSCMLYFGIYPEDYSINRKRLTRQWMAEGFVKNGE






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox