PRGDB00049007 (Ve1)

From PRG Wiki
Jump to: navigation, search
Ve1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 65332098 (DQ020574)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Solanum torvum

Comment?

Solanum torvum verticillium wilt disease resistance protein (Ve1) mRNA, complete cds.

DNA Sequence

ATGAAAATGATGACAACTCTCCACTTTCTTTGGATTTTCTTGATTCCCTTGTTTCAAATCTTATCAGTAATTGACATTTTATTGGTTTCCTCTCAATGTCTTGATGATCAAATGTCATTGTTGCTGCAATTGAAGGGCAGCCTCCAATATGATTCTAGTTTGTCAAATAAATTGGCAAAATGGAACCACAAGACAAGTGAATGTTGCATTTGGGATGGGGTTACATGTGATCCCTCTGGTCATGTGATTGCCTTGGAACTTGATGAGGAGACTATTTCTAGTGGGATTGAGAATTCAAGTGCTCTTTTCAGTCTTCAGTGTCTTGAGAAGCTAAATTTAGCTTACAACAGGTTCAGTGTTGGCATACCAGTTGGTATCTCCAACCTCACCAACTTGAAGTACCTGAATTTATCGAATGCTGGTTTTCTTGGCCAAATTCCTATGGTGTTGCCGAGATTAACAAAGCTAGTTACTCTTGATCTCTCAACTCTTTTCCCTGATGCAATCAAGCCACTAAAACTTGAGAATCCCAATTTGAGACATTTCATTGAGAACTCAACAGAGCTTAAAGAGCCTTACCTTGATGGTGTTGATCTTTCAGCTCAGAGGACTGATTGGTGTCAATCTTTATCTTCATCTTTGCCTAACTTGACCGTCTTGAGCTTGTGTACTTGTCAAATTTCAGGCCCTATTGATGAATCACTTTCTCAGCTTCTTTTTCTATCTATCATCCATCTTGACCAGAACAATCTATCTACCACAGTTCCTGAATATTTTTCCAATTTCTCAAACATAACTACCTTGACCCTCGGTTATTGCAATCTGAAGGGAACATTTCCGGAAAGAATTTTTCAGGTACCAGTTTTAGAGATTTTGGACTTGTCAGATAACAAGGTTCTTAGTGGTAGTGTTCCGAGTTTTCCTCGATATGGATCTATGAGGAGGATATCTCTAAGGTACACCAACTTTTCTGGTTCATTACCAGAGTCCATTTCGAACCTTCACAACCTGTCCAGGTTAGAGCTCTCCAATTGCAATTTCAATGGATCAATACCCTCCACAATGGCAAAACTTACCAATCTTATTTATTTAGATTTCTCCTTCAACAACTTCACTGGTTTTATCCCATATTTCCAACGGTCCAAGAAACTCACCTACTTAGACCTTTCACGTAATGGTCTAACTGGTCAATTGTCTAGAGCTCATTTCGAAGGACTCTCAGAGCTCGTCTACATGAATTTAGGGGACAATTCACTAAACGGGATCCTTCCTGCAGACATATTTGAGCTCCCCTCCTTGCAGCAGCTTTTTCTTTACAGCAATCAATTTGTTGGCCAAGTCGATGAGTTCCGTAATGCATCCTCCTCTCTGTTAGATACAATCGATTTGAACAACAACAACCTGAGTGGTTCAATTCCCAAGTCCATGCTTGAAGTTGGGAAGCTTAAGGTCCTCTCACTTTCTTCCAACTTCTTTAGTGGTACAGTGCCCCTTTACCTCATTGGGAAGCTGAGCAACCTTTCAAGACTGGAGCTTTCTTACAATAACTTGACTGTCGATGCAAGTAGCAGCAATTCAACCTCTTTCGCATTTCCTCAGTTGAATATATTGAAATTAGCTTCTTGTCGGCTGCATAAGTTCCCTGATCTCAAGAATCAGTCAAGGATGATCCACTTAGACCTTTCAAACAACCAAATACAGTGGGCAATACCAAATTGGATTTGGGGAATTGGTGGTGGAGCTCTTGCTCACCTGAATCTTTCCTTCAATCATCTGGAGTCTGTGGAGCAGCCTTACAATGCTTCCAGCAATCTTGTCGTCTTTGACTTACATTCCAACCATATAAAAGGTGACTTACCAATTCCACCTCCCTCTGCCATCTATGTGGACTACTCGAGCAATAATTTAAGCAATTCCATGCCACCAGATATTGGAAATTCTCTTGCTCTTGCCTCCTTTTTCTCAGTAGCAAACAATGACATCACTGGAATAATTCCTGAATCCATATGCAACATCAGCTACCTTAAAGTTCTTGATTTGTCTAACAATAAATTGAGTGGAACAATACCACGACGTCTACTGAATAATAGAACAGCTCTTGGAGTGCTGAATCTAGGGAACAACAGACTCCATGGTGTTATACCAGATTCATTTCCAATTGGTTGTTCTCTAAAAACTTTAGACCTCAGTAGGAATACCTTCGAAGGGAAGCTACCAAAATCGCTTTTCAACTGCACATTTTTGGAGGTCCTGAATGTTGGACATAACAGACTTGTTGATCAGTTCCCATGCATGTTGAGGAACTCAAACTGTCTGAGGGTCCTAGTCTTGCGCTCCAATCAATTCAATGGAAATCTTACATGTGAGATAACCACAAATAGCTGGCAGGATCTCCAGATCATAGATATAGCTTCCAACAGCTTTACTGGTGTGTTGAATGCGGAATGCTTTTCTAATTGGAGAGGAATGATGGTTGCACATGATTACGTGGAGACAGGACGCAGTTATATCCAGTATAAGTTCCTCCAACTAAGTAACTTTTACTATCAGGACACAGTGACATTAACCATCAAAGGCATGGAGCTGGAGCTTGTGAAGATTCTCAGGGTCTTCACATCTATTGATTTCTCTTCAAATGGATTTCATGGAGTGATACCAGACACGGTTGGGGACCTTATCTCGCTTTATTTGCTGAACCTGTCACACAATGCCCTTGAGGGACCAATTCCAAGATCAATTGGGAAGCTACAAATGCTTGAATCACTAGACCTGTCAACAAACCAGCTGTCCGGAGAGATCCCCTCAGAGCTTGCAAGTCTCACGTTCTTAGCAGCTTTGAACCTATCATTCAACAATTTGTTTGGCAAAATCCCGCAAGGTATTCAGCTGCAAACATTCTCAGGAGATTCCTTTGAAGGAAACCGAGGCCTATGCGGGTTCCCTCTCAACAACAGTTGTGAAAGCAAGAGATCAGAGTTCATGCCGCCGCAAACTTCGCTACCAGACTCAGATTTTGAATGGAAGTTCATCTTCGCGGCTGTTGGATACATAGTAGGGGCAGCAAACACTATTTCACTTCTGTGGTTTTACGAGCCAGTGAAGAGATGGTTTGATAAGCATACAGAGAAATGCTTGCTTTGGTTTTCAAGGAAGTGA


Protein sequences

Name Description Sequence
verticillium wilt disease resistance protein verticillium wilt disease resistance protein [Solanum torvum].

MKMMTTLHFLWIFLIPLFQILSVIDILLVSSQCLDDQMSLLLQLKGSLQYDSSLSNKLAKWNHKTSECCIWDGVTCDPSGHVIALELDEETISSGIENSSALFSLQCLEKLNLAYNRFSVGIPVGISNLTNLKYLNLSNAGFLGQIPMVLPRLTKLVTLDLSTLFPDAIKPLKLENPNLRHFIENSTELKEPYLDGVDLSAQRTDWCQSLSSSLPNLTVLSLCTCQISGPIDESLSQLLFLSIIHLDQNNLSTTVPEYFSNFSNITTLTLGYCNLKGTFPERIFQVPVLEILDLSDNKVLSGSVPSFPRYGSMRRISLRYTNFSGSLPESISNLHNLSRLELSNCNFNGSIPSTMAKLTNLIYLDFSFNNFTGFIPYFQRSKKLTYLDLSRNGLTGQLSRAHFEGLSELVYMNLGDNSLNGILPADIFELPSLQQLFLYSNQFVGQVDEFRNASSSLLDTIDLNNNNLSGSIPKSMLEVGKLKVLSLSSNFFSGTVPLYLIGKLSNLSRLELSYNNLTVDASSSNSTSFAFPQLNILKLASCRLHKFPDLKNQSRMIHLDLSNNQIQWAIPNWIWGIGGGALAHLNLSFNHLESVEQPYNASSNLVVFDLHSNHIKGDLPIPPPSAIYVDYSSNNLSNSMPPDIGNSLALASFFSVANNDITGIIPESICNISYLKVLDLSNNKLSGTIPRRLLNNRTALGVLNLGNNRLHGVIPDSFPIGCSLKTLDLSRNTFEGKLPKSLFNCTFLEVLNVGHNRLVDQFPCMLRNSNCLRVLVLRSNQFNGNLTCEITTNSWQDLQIIDIASNSFTGVLNAECFSNWRGMMVAHDYVETGRSYIQYKFLQLSNFYYQDTVTLTIKGMELELVKILRVFTSIDFSSNGFHGVIPDTVGDLISLYLLNLSHNALEGPIPRSIGKLQMLESLDLSTNQLSGEIPSELASLTFLAALNLSFNNLFGKIPQGIQLQTFSGDSFEGNRGLCGFPLNNSCESKRSEFMPPQTSLPDSDFEWKFIFAAVGYIVGAANTISLLWFYEPVKRWFDKHTEKCLLWFSRK


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF473
1-986 PTHR24420:SF473,SUBFAMILY NOT NAMED

MKMMTTLHFLWIFLIPLFQILSVIDILLVSSQCLDDQMSLLLQLKGSLQYDSSLSNKLAKWNHKTSECCIWDGVTCDPSGHVIALELDEETISSGIENSSALFSLQCLEKLNLAYNRFSVGIPVGISNLTNLKYLNLSNAGFLGQIPMVLPRLTKLVTLDLSTLFPDAIKPLKLENPNLRHFIENSTELKEPYLDGVDLSAQRTDWCQSLSSSLPNLTVLSLCTCQISGPIDESLSQLLFLSIIHLDQNNLSTTVPEYFSNFSNITTLTLGYCNLKGTFPERIFQVPVLEILDLSDNKVLSGSVPSFPRYGSMRRISLRYTNFSGSLPESISNLHNLSRLELSNCNFNGSIPSTMAKLTNLIYLDFSFNNFTGFIPYFQRSKKLTYLDLSRNGLTGQLSRAHFEGLSELVYMNLGDNSLNGILPADIFELPSLQQLFLYSNQFVGQVDEFRNASSSLLDTIDLNNNNLSGSIPKSMLEVGKLKVLSLSSNFFSGTVPLYLIGKLSNLSRLELSYNNLTVDASSSNSTSFAFPQLNILKLASCRLHKFPDLKNQSRMIHLDLSNNQIQWAIPNWIWGIGGGALAHLNLSFNHLESVEQPYNASSNLVVFDLHSNHIKGDLPIPPPSAIYVDYSSNNLSNSMPPDIGNSLALASFFSVANNDITGIIPESICNISYLKVLDLSNNKLSGTIPRRLLNNRTALGVLNLGNNRLHGVIPDSFPIGCSLKTLDLSRNTFEGKLPKSLFNCTFLEVLNVGHNRLVDQFPCMLRNSNCLRVLVLRSNQFNGNLTCEITTNSWQDLQIIDIASNSFTGVLNAECFSNWRGMMVAHDYVETGRSYIQYKFLQLSNFYYQDTVTLTIKGMELELVKILRVFTSIDFSSNGFHGVIPDTVGDLISLYLLNLSHNALEGPIPRSIGKLQMLESLDLSTNQLSGEIPSELASLTFLAALNLSFNNLFGKIPQGIQLQTFSGDSFEGNRGLCGFPLNNSC

HMMPanther: PTHR24420
1-986 PTHR24420,FAMILY NOT NAMED

MKMMTTLHFLWIFLIPLFQILSVIDILLVSSQCLDDQMSLLLQLKGSLQYDSSLSNKLAKWNHKTSECCIWDGVTCDPSGHVIALELDEETISSGIENSSALFSLQCLEKLNLAYNRFSVGIPVGISNLTNLKYLNLSNAGFLGQIPMVLPRLTKLVTLDLSTLFPDAIKPLKLENPNLRHFIENSTELKEPYLDGVDLSAQRTDWCQSLSSSLPNLTVLSLCTCQISGPIDESLSQLLFLSIIHLDQNNLSTTVPEYFSNFSNITTLTLGYCNLKGTFPERIFQVPVLEILDLSDNKVLSGSVPSFPRYGSMRRISLRYTNFSGSLPESISNLHNLSRLELSNCNFNGSIPSTMAKLTNLIYLDFSFNNFTGFIPYFQRSKKLTYLDLSRNGLTGQLSRAHFEGLSELVYMNLGDNSLNGILPADIFELPSLQQLFLYSNQFVGQVDEFRNASSSLLDTIDLNNNNLSGSIPKSMLEVGKLKVLSLSSNFFSGTVPLYLIGKLSNLSRLELSYNNLTVDASSSNSTSFAFPQLNILKLASCRLHKFPDLKNQSRMIHLDLSNNQIQWAIPNWIWGIGGGALAHLNLSFNHLESVEQPYNASSNLVVFDLHSNHIKGDLPIPPPSAIYVDYSSNNLSNSMPPDIGNSLALASFFSVANNDITGIIPESICNISYLKVLDLSNNKLSGTIPRRLLNNRTALGVLNLGNNRLHGVIPDSFPIGCSLKTLDLSRNTFEGKLPKSLFNCTFLEVLNVGHNRLVDQFPCMLRNSNCLRVLVLRSNQFNGNLTCEITTNSWQDLQIIDIASNSFTGVLNAECFSNWRGMMVAHDYVETGRSYIQYKFLQLSNFYYQDTVTLTIKGMELELVKILRVFTSIDFSSNGFHGVIPDTVGDLISLYLLNLSHNALEGPIPRSIGKLQMLESLDLSTNQLSGEIPSELASLTFLAALNLSFNNLFGKIPQGIQLQTFSGDSFEGNRGLCGFPLNNSC

Gene3D: G3DSA:3.80.10.10
32-189 G3DSA:3.80.10.10

QCLDDQMSLLLQLKGSLQYDSSLSNKLAKWNHKTSECCIWDGVTCDPSGHVIALELDEETISSGIENSSALFSLQCLEKLNLAYNRFSVGIPVGISNLTNLKYLNLSNAGFLGQIPMVLPRLTKLVTLDLSTLFPDAIKPLKLENPNLRHFIENSTEL

HMMPfam: PF08263
IPR013210
35-77 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

DDQMSLLLQLKGSLQYDSSLSNKLAKWNHKTSECCIWDGVTCD

superfamily: SSF52047
62-307 SSF52047,LRR

NHKTSECCIWDGVTCDPSGHVIALELDEETISSGIENSSALFSLQCLEKLNLAYNRFSVGIPVGISNLTNLKYLNLSNAGFLGQIPMVLPRLTKLVTLDLSTLFPDAIKPLKLENPNLRHFIENSTELKEPYLDGVDLSAQRTDWCQSLSSSLPNLTVLSLCTCQISGPIDESLSQLLFLSIIHLDQNNLSTTVPEYFSNFSNITTLTLGYCNLKGTFPERIFQVPVLEILDLSDNKVLSGSVPSF

HMMPfam: PF13504
130-147 LRR_7,Leucine rich repeat

TNLKYLNLSNAGFLGQIP

Gene3D: G3DSA:3.80.10.10
211-453 G3DSA:3.80.10.10

SSSLPNLTVLSLCTCQISGPIDESLSQLLFLSIIHLDQNNLSTTVPEYFSNFSNITTLTLGYCNLKGTFPERIFQVPVLEILDLSDNKVLSGSVPSFPRYGSMRRISLRYTNFSGSLPESISNLHNLSRLELSNCNFNGSIPSTMAKLTNLIYLDFSFNNFTGFIPYFQRSKKLTYLDLSRNGLTGQLSRAHFEGLSELVYMNLGDNSLNGILPADIFELPSLQQLFLYSNQFVGQVDEFRNA

superfamily: SSF52047
302-576 SSF52047,LRR

GSVPSFPRYGSMRRISLRYTNFSGSLPESISNLHNLSRLELSNCNFNGSIPSTMAKLTNLIYLDFSFNNFTGFIPYFQRSKKLTYLDLSRNGLTGQLSRAHFEGLSELVYMNLGDNSLNGILPADIFELPSLQQLFLYSNQFVGQVDEFRNASSSLLDTIDLNNNNLSGSIPKSMLEVGKLKVLSLSSNFFSGTVPLYLIGKLSNLSRLELSYNNLTVDASSSNSTSFAFPQLNILKLASCRLHKFPDLKNQSRMIHLDLSNNQIQWAIPNWIWG

HMMPfam: PF00560
IPR001611
360-379 LRR_1
Leucine-rich repeat

NLIYLDFSFNNFTGFIPYFQ

HMMPfam: PF13855
383-442 LRR_8,Leucine rich repeat

KLTYLDLSRNGLTGQLSRAHFEGLSELVYMNLGDNSLNGILPADIFELPSLQQLFLYSNQ

Gene3D: G3DSA:3.80.10.10
458-636 G3DSA:3.80.10.10

LDTIDLNNNNLSGSIPKSMLEVGKLKVLSLSSNFFSGTVPLYLIGKLSNLSRLELSYNNLTVDASSSNSTSFAFPQLNILKLASCRLHKFPDLKNQSRMIHLDLSNNQIQWAIPNWIWGIGGGALAHLNLSFNHLESVEQPYNASSNLVVFDLHSNHIKGDLPIPPPSAIYVDYSSNNL

HMMPfam: PF00560
IPR001611
557-574 LRR_1
Leucine-rich repeat

IHLDLSNNQIQWAIPNWI

superfamily: SSF52058
624-986 SSF52058,LRR

PSAIYVDYSSNNLSNSMPPDIGNSLALASFFSVANNDITGIIPESICNISYLKVLDLSNNKLSGTIPRRLLNNRTALGVLNLGNNRLHGVIPDSFPIGCSLKTLDLSRNTFEGKLPKSLFNCTFLEVLNVGHNRLVDQFPCMLRNSNCLRVLVLRSNQFNGNLTCEITTNSWQDLQIIDIASNSFTGVLNAECFSNWRGMMVAHDYVETGRSYIQYKFLQLSNFYYQDTVTLTIKGMELELVKILRVFTSIDFSSNGFHGVIPDTVGDLISLYLLNLSHNALEGPIPRSIGKLQMLESLDLSTNQLSGEIPSELASLTFLAALNLSFNNLFGKIPQGIQLQTFSGDSFEGNRGLCGFPLNNSC

Gene3D: G3DSA:3.80.10.10
637-820 G3DSA:3.80.10.10

SNSMPPDIGNSLALASFFSVANNDITGIIPESICNISYLKVLDLSNNKLSGTIPRRLLNNRTALGVLNLGNNRLHGVIPDSFPIGCSLKTLDLSRNTFEGKLPKSLFNCTFLEVLNVGHNRLVDQFPCMLRNSNCLRVLVLRSNQFNGNLTCEITTNSWQDLQIIDIASNSFTGVLNAECFSNW

FPrintScan: PR00019
675-688 LEURICHRPT,Leucine-rich repeat signature

LKVLDLSNNKLSGT

HMMPfam: PF00560
IPR001611
675-694 LRR_1
Leucine-rich repeat

LKVLDLSNNKLSGTIPRRLL

HMMPfam: PF13855
723-781 LRR_8,Leucine rich repeat

SLKTLDLSRNTFEGKLPKSLFNCTFLEVLNVGHNRLVDQFPCMLRNSNCLRVLVLRSNQ

Gene3D: G3DSA:3.80.10.10
868-961 G3DSA:3.80.10.10

LRVFTSIDFSSNGFHGVIPDTVGDLISLYLLNLSHNALEGPIPRSIGKLQMLESLDLSTNQLSGEIPSELASLTFLAALNLSFNNLFGKIPQGI

FPrintScan: PR00019
916-929 LEURICHRPT,Leucine-rich repeat signature

LQMLESLDLSTNQL

HMMPfam: PF00560
IPR001611
919-940 LRR_1
Leucine-rich repeat

LESLDLSTNQLSGEIPSELASL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox