PRGDB00049008 (Ve)

From PRG Wiki
Jump to: navigation, search
Ve
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 34761799 (AY311527)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Solanum torvum

Comment?

Solanum torvum verticillium wilt disease resistance protein precursor (Ve) mRNA, complete cds.

DNA Sequence

ATGAGATTTTTACACTTTCTATGGCTCTTCTTGATACCCTTTTTCCAAATCCTATCAGGTATTGAGATTTTCTTGGTTTCCTCTCAATGTCTTGATCATCAAAAGTCATTGTTGCTGAAGTTAAATGGCACCCTCCAATATGATTCTAGTTTGTCAACAAAGTTGGCACGTTGGAACCAAAACACAAGTGAATGTTGCAATTGGGATGGGGTTACATGTGATCTCTCTGGTCATGTGATTGCCTTGGAACTTGATAATGAGACTATTTCTAGTGGAATTGAGAATTCAAGTGCTCTTTTCAGTCTTCAGTATCTTGAGAAGCTAAATTTGGCTTACAACAGGTTCAGTGTTGGCATACCAGTCGGTATATCCAACCTCACCAACTTGAAGTACCTGAATTTATCGAATGCTGGTTTTCTTGGCCAAATTCCTATGATGTTATCAAGATTAACAAGGCTAGTTACTCTTGATCTCTCAACTCTTTTCCCTGATGCAATCCATCCACTAAAACTTGAGAATCCCAATTTGACACACTTCATTGAGAACTCAACAGAGCTTAGAGAGCTTTACCTTGATGGTGTTGATCTTTCAGCTCAAAGGGCTGAGTGGTGTCAATCTTTATCTTCATATTTGCCTAACTTGACCGTCTTGAGCTTGCGTACTTGTCAAATTTCAGGGCCGATTGATGACTCACTTTCTCAGCTTCAGTTTCTCTCTATAATCCGTCTTGACCAGAACAATCTCTCTACCACAGTTCCTGAATATTTTTCCAATTTCTCCAACCTAACTACCTTGACTCTCGGCTCTTGTAATCTGCAGGGAACATTTCCGGAAAGAATCTTTCAGGTATCAGTTTTAGAGGTTTTGGAGCTGTCAAATAACAAGTTGCTTAGTGGTAGTATTCAGAATTTTCCTCGATATGGATCTTTGAGGAGGATATCACTAAGCTACACCAGCTTTTCTGGTTCATTGCCAGAGTCCATTTCGAACCTTCAAAATCTGTCCAGGTTAGAGCTCTCCAATTGCAATTTCAATGGTCCAATACCTTCCACAATGGCAAACCTTACCAATCTTGTTTATTTAGATTTCTCCTTCAACAACTTCACTGGTTTTATTCCATATTTCCAACGGTCCAAGAAACTCACCTACTTAGACCTTTCACGTAATGGTCTAACTGGTCTCTTGTCTAGAGCTCATTTTGAAGGACTCTCAGAGCTTGTCTACATGAGTTTAGGGAACAATTCACTCAACGGGATCCTTCCTGCAGAAATATTTGAGCTCCCCTCCTTGCAGCAGCTTTCTCTTTACAGCAATCAGTTTGTTGGCCAAGTCGATGAGTTCCGCAATGCATCCTCCTCTCCGTTAGATACAATCGATTTGAGAAACAACCACCTGAATGGTTCAATTCCCAAGTCTATGTTTGAAGTTGGGAGGCTTAAGGTCCTCTCACTTTCTTTCAACTTCTTTAGTGGGACAGTGTCCCTTGATCTCATTGGGAAGCTGAGCAACCTTTCAAAACTGGAGCTTTCTTACAATAACTTGACTGTTGATGCAAGTAGCAGCAATTCTACCTCTTTCGCATTTCCCCAGTTGAGTATATTGAAATTAGCTTCTTGTCGGCTGCAAAAGTTCCCTGATCTCAAGAATCAGTCAAGGATGATCCACTTAGACCTTTCAGACAACCAAATAGGGGGGGCAATACCAAATTGGATTTGGGGAATTGGAGGTGGGGCTCTTGCTCACCTGAATCTTTCTTTCAATCATCTGGAGTACGTGGAACAGCCGTACAATGCTTCCAACAATCTTGTAGTCTTTGACTTGCATTCCAACAATATAAAAGGTGACTTACCAATTCCACCTCCCTCTGCCATCTATGTGGACTACTCGAGCAATAATTTAAACAATTCCATCCCACTTGATATTGGAAATTCTCTTGCTCTTGCCTCCTTTTTCTCGATAGCAAACAATAGCATCACTGGAATGATTCCTGAATCCATATGCAACATCAGCTACCTTCAAGTTCTTGACTTGTCTAACAATAAATTGAGTGGAACAATACCACCATGTTTATTGCATAATAGTACATCTCTTGGAGTGCTGAATCTAGGGAACAATAGACTCCATGGTGTTATACCAGATTCATTTCCAATTGGTTGTGCTCTAAAAACTTTAGACCTTAGTAGGAATACCTTTGAAGGGAAGCTACCAAAATCGCTTGTCAACTGCACATTGTTGGAGGTCCTGAATGTTGGAAATAACAGACTTGTCGATCGCTTCCCATGCATGCTGAGTAACTCAAACAGTCTGAGCGTCCTAGTTTTGCGCTCCAATCAATTCAATGGAAATCTTACATGTGATATAACCACAAATAGCTGGCAGGATCTCCAGATCATAGATATAGCTTCCAACAGGTTTACTGGTGTGTTGAATCCGGAATGCTTTTCTAATTGGAGAGGAATGATAGTTGCACATGATAACGTGGAGACAGCACACAATCATATCCAGTATAAGTTCCTCCAACTAAGTAACTTTTACTATCAGGACACAGTGACATTAACCATCAAAGGCATGGAGCTGGAGCTTGTGAAGATTCTCAGAGTCTTCACATCTATTGATTTCTCTTCAAATAGATTTCACGGAATGATACCAGACACGGTTGGGGATCTCAGCTCGCTTTATCTTCTGAACCTGTCATACAATGCCCTTGAAGGACCAATTCCAAAATCAGTAGGGAAGCTACAAATGCTTGAATCACTAGACCTGTCAACAAACCATCTGTCCGGAGAGATCCCCTCAGAGCTTGCAAGTCTCACATTCTTAGCTGCTTTGAACGTATCATTCAACAATTTGTTTGGCAAAATCCCGCAAGGTATTCAGCTTCAAACATTCTCAGGAGATTCCTTTGAAGGAAACCGAGGCCTATGCGGGTTCCCTCTGAGCAACAGTTGCAAAAGTGATGCTTCAGAGTTGACACCAGCACCAAGTTCTCAAGATGACTCTTATGATTGGCAGTTCATATTTAAGGGTGTGGGATATGGAGTAGGGGCAGCAGTCTCCATTGCACCTCTGTTGTTTTACAAGCGAGGGAGGAAATACTGTGACAAACATTTGGAGAGAATGCTTAAACTGATGTTTCCAAGATTTGGGTTCACTTACACCAGATTTCACCCTGGGAAGGTTGTGGCAGTGGAACACTACGAAGATGAGACCCCAGATGACACCGAAGACGACGATGAGGGGGGAAAGGAAGCATCTCTTGGGCGTTATTGTGTCTTCTGTAGTAAACTTGATTTTCAAAGAAAGGAAGCAATACATGATCCAAAATGCACTTGTCATATGTCATCATCCCTCATTTCTTTTCCTCTTGCACCATCCTCTTCTTCACCTTTATTGGTCATATGTCACAAAAAGTTTTGA


Protein sequences

Name Description Sequence
verticillium wilt disease resistance protein precursor verticillium wilt disease resistance protein precursor [Solanum torvum].

MRFLHFLWLFLIPFFQILSGIEIFLVSSQCLDHQKSLLLKLNGTLQYDSSLSTKLARWNQNTSECCNWDGVTCDLSGHVIALELDNETISSGIENSSALFSLQYLEKLNLAYNRFSVGIPVGISNLTNLKYLNLSNAGFLGQIPMMLSRLTRLVTLDLSTLFPDAIHPLKLENPNLTHFIENSTELRELYLDGVDLSAQRAEWCQSLSSYLPNLTVLSLRTCQISGPIDDSLSQLQFLSIIRLDQNNLSTTVPEYFSNFSNLTTLTLGSCNLQGTFPERIFQVSVLEVLELSNNKLLSGSIQNFPRYGSLRRISLSYTSFSGSLPESISNLQNLSRLELSNCNFNGPIPSTMANLTNLVYLDFSFNNFTGFIPYFQRSKKLTYLDLSRNGLTGLLSRAHFEGLSELVYMSLGNNSLNGILPAEIFELPSLQQLSLYSNQFVGQVDEFRNASSSPLDTIDLRNNHLNGSIPKSMFEVGRLKVLSLSFNFFSGTVSLDLIGKLSNLSKLELSYNNLTVDASSSNSTSFAFPQLSILKLASCRLQKFPDLKNQSRMIHLDLSDNQIGGAIPNWIWGIGGGALAHLNLSFNHLEYVEQPYNASNNLVVFDLHSNNIKGDLPIPPPSAIYVDYSSNNLNNSIPLDIGNSLALASFFSIANNSITGMIPESICNISYLQVLDLSNNKLSGTIPPCLLHNSTSLGVLNLGNNRLHGVIPDSFPIGCALKTLDLSRNTFEGKLPKSLVNCTLLEVLNVGNNRLVDRFPCMLSNSNSLSVLVLRSNQFNGNLTCDITTNSWQDLQIIDIASNRFTGVLNPECFSNWRGMIVAHDNVETAHNHIQYKFLQLSNFYYQDTVTLTIKGMELELVKILRVFTSIDFSSNRFHGMIPDTVGDLSSLYLLNLSYNALEGPIPKSVGKLQMLESLDLSTNHLSGEIPSELASLTFLAALNVSFNNLFGKIPQGIQLQTFSGDSFEGNRGLCGFPLSNSCKSDASELTPAPSSQDDSYDWQFIFKGVGYGVGAAVSIAPLLFYKRGRKYCDKHLERMLKLMFPRFGFTYTRFHPGKVVAVEHYEDETPDDTEDDDEGGKEASLGRYCVFCSKLDFQRKEAIHDPKCTCHMSSSLISFPLAPSSSSPLLVICHKKF


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF473
4-1028 PTHR24420:SF473,SUBFAMILY NOT NAMED

LHFLWLFLIPFFQILSGIEIFLVSSQCLDHQKSLLLKLNGTLQYDSSLSTKLARWNQNTSECCNWDGVTCDLSGHVIALELDNETISSGIENSSALFSLQYLEKLNLAYNRFSVGIPVGISNLTNLKYLNLSNAGFLGQIPMMLSRLTRLVTLDLSTLFPDAIHPLKLENPNLTHFIENSTELRELYLDGVDLSAQRAEWCQSLSSYLPNLTVLSLRTCQISGPIDDSLSQLQFLSIIRLDQNNLSTTVPEYFSNFSNLTTLTLGSCNLQGTFPERIFQVSVLEVLELSNNKLLSGSIQNFPRYGSLRRISLSYTSFSGSLPESISNLQNLSRLELSNCNFNGPIPSTMANLTNLVYLDFSFNNFTGFIPYFQRSKKLTYLDLSRNGLTGLLSRAHFEGLSELVYMSLGNNSLNGILPAEIFELPSLQQLSLYSNQFVGQVDEFRNASSSPLDTIDLRNNHLNGSIPKSMFEVGRLKVLSLSFNFFSGTVSLDLIGKLSNLSKLELSYNNLTVDASSSNSTSFAFPQLSILKLASCRLQKFPDLKNQSRMIHLDLSDNQIGGAIPNWIWGIGGGALAHLNLSFNHLEYVEQPYNASNNLVVFDLHSNNIKGDLPIPPPSAIYVDYSSNNLNNSIPLDIGNSLALASFFSIANNSITGMIPESICNISYLQVLDLSNNKLSGTIPPCLLHNSTSLGVLNLGNNRLHGVIPDSFPIGCALKTLDLSRNTFEGKLPKSLVNCTLLEVLNVGNNRLVDRFPCMLSNSNSLSVLVLRSNQFNGNLTCDITTNSWQDLQIIDIASNRFTGVLNPECFSNWRGMIVAHDNVETAHNHIQYKFLQLSNFYYQDTVTLTIKGMELELVKILRVFTSIDFSSNRFHGMIPDTVGDLSSLYLLNLSYNALEGPIPKSVGKLQMLESLDLSTNHLSGEIPSELASLTFLAALNVSFNNLFGKIPQGIQLQTFSGDSFEGNRGLCGFPLSNSCKSDASELTPAPSSQDDSYDWQFIFKGVGYGVGAAVSIAPLLFYKR

HMMPanther: PTHR24420
4-1028 PTHR24420,FAMILY NOT NAMED

LHFLWLFLIPFFQILSGIEIFLVSSQCLDHQKSLLLKLNGTLQYDSSLSTKLARWNQNTSECCNWDGVTCDLSGHVIALELDNETISSGIENSSALFSLQYLEKLNLAYNRFSVGIPVGISNLTNLKYLNLSNAGFLGQIPMMLSRLTRLVTLDLSTLFPDAIHPLKLENPNLTHFIENSTELRELYLDGVDLSAQRAEWCQSLSSYLPNLTVLSLRTCQISGPIDDSLSQLQFLSIIRLDQNNLSTTVPEYFSNFSNLTTLTLGSCNLQGTFPERIFQVSVLEVLELSNNKLLSGSIQNFPRYGSLRRISLSYTSFSGSLPESISNLQNLSRLELSNCNFNGPIPSTMANLTNLVYLDFSFNNFTGFIPYFQRSKKLTYLDLSRNGLTGLLSRAHFEGLSELVYMSLGNNSLNGILPAEIFELPSLQQLSLYSNQFVGQVDEFRNASSSPLDTIDLRNNHLNGSIPKSMFEVGRLKVLSLSFNFFSGTVSLDLIGKLSNLSKLELSYNNLTVDASSSNSTSFAFPQLSILKLASCRLQKFPDLKNQSRMIHLDLSDNQIGGAIPNWIWGIGGGALAHLNLSFNHLEYVEQPYNASNNLVVFDLHSNNIKGDLPIPPPSAIYVDYSSNNLNNSIPLDIGNSLALASFFSIANNSITGMIPESICNISYLQVLDLSNNKLSGTIPPCLLHNSTSLGVLNLGNNRLHGVIPDSFPIGCALKTLDLSRNTFEGKLPKSLVNCTLLEVLNVGNNRLVDRFPCMLSNSNSLSVLVLRSNQFNGNLTCDITTNSWQDLQIIDIASNRFTGVLNPECFSNWRGMIVAHDNVETAHNHIQYKFLQLSNFYYQDTVTLTIKGMELELVKILRVFTSIDFSSNRFHGMIPDTVGDLSSLYLLNLSYNALEGPIPKSVGKLQMLESLDLSTNHLSGEIPSELASLTFLAALNVSFNNLFGKIPQGIQLQTFSGDSFEGNRGLCGFPLSNSCKSDASELTPAPSSQDDSYDWQFIFKGVGYGVGAAVSIAPLLFYKR

Gene3D: G3DSA:3.80.10.10
29-297 G3DSA:3.80.10.10

QCLDHQKSLLLKLNGTLQYDSSLSTKLARWNQNTSECCNWDGVTCDLSGHVIALELDNETISSGIENSSALFSLQYLEKLNLAYNRFSVGIPVGISNLTNLKYLNLSNAGFLGQIPMMLSRLTRLVTLDLSTLFPDAIHPLKLENPNLTHFIENSTELRELYLDGVDLSAQRAEWCQSLSSYLPNLTVLSLRTCQISGPIDDSLSQLQFLSIIRLDQNNLSTTVPEYFSNFSNLTTLTLGSCNLQGTFPERIFQVSVLEVLELSNNKLL

HMMPfam: PF08263
IPR013210
32-74 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

DHQKSLLLKLNGTLQYDSSLSTKLARWNQNTSECCNWDGVTCD

superfamily: SSF52047
59-304 SSF52047,LRR

NQNTSECCNWDGVTCDLSGHVIALELDNETISSGIENSSALFSLQYLEKLNLAYNRFSVGIPVGISNLTNLKYLNLSNAGFLGQIPMMLSRLTRLVTLDLSTLFPDAIHPLKLENPNLTHFIENSTELRELYLDGVDLSAQRAEWCQSLSSYLPNLTVLSLRTCQISGPIDDSLSQLQFLSIIRLDQNNLSTTVPEYFSNFSNLTTLTLGSCNLQGTFPERIFQVSVLEVLELSNNKLLSGSIQNF

HMMPfam: PF12799
104-137 LRR_4,Leucine Rich repeats (2 copies)

YLEKLNLAYNRFSVGIPVGISNLTNLKYLNLSNA

Gene3D: G3DSA:3.80.10.10
303-536 G3DSA:3.80.10.10

NFPRYGSLRRISLSYTSFSGSLPESISNLQNLSRLELSNCNFNGPIPSTMANLTNLVYLDFSFNNFTGFIPYFQRSKKLTYLDLSRNGLTGLLSRAHFEGLSELVYMSLGNNSLNGILPAEIFELPSLQQLSLYSNQFVGQVDEFRNASSSPLDTIDLRNNHLNGSIPKSMFEVGRLKVLSLSFNFFSGTVSLDLIGKLSNLSKLELSYNNLTVDASSSNSTSFAFPQLSILKL

superfamily: SSF52047
309-573 SSF52047,LRR

SLRRISLSYTSFSGSLPESISNLQNLSRLELSNCNFNGPIPSTMANLTNLVYLDFSFNNFTGFIPYFQRSKKLTYLDLSRNGLTGLLSRAHFEGLSELVYMSLGNNSLNGILPAEIFELPSLQQLSLYSNQFVGQVDEFRNASSSPLDTIDLRNNHLNGSIPKSMFEVGRLKVLSLSFNFFSGTVSLDLIGKLSNLSKLELSYNNLTVDASSSNSTSFAFPQLSILKLASCRLQKFPDLKNQSRMIHLDLSDNQIGGAIPNWIWG

HMMPfam: PF00560
IPR001611
357-376 LRR_1
Leucine-rich repeat

NLVYLDFSFNNFTGFIPYFQ

HMMPfam: PF13855
380-439 LRR_8,Leucine rich repeat

KLTYLDLSRNGLTGLLSRAHFEGLSELVYMSLGNNSLNGILPAEIFELPSLQQLSLYSNQ

FPrintScan: PR00019
381-394 LEURICHRPT,Leucine-rich repeat signature

LTYLDLSRNGLTGL

Gene3D: G3DSA:3.80.10.10
537-715 G3DSA:3.80.10.10

ASCRLQKFPDLKNQSRMIHLDLSDNQIGGAIPNWIWGIGGGALAHLNLSFNHLEYVEQPYNASNNLVVFDLHSNNIKGDLPIPPPSAIYVDYSSNNLNNSIPLDIGNSLALASFFSIANNSITGMIPESICNISYLQVLDLSNNKLSGTIPPCLLHNSTSLGVLNLGNNRLHGVIPDSF

HMMPfam: PF13516
554-566 LRR_6,Leucine Rich repeat

IHLDLSDNQIGGA

superfamily: SSF52058
621-983 SSF52058,LRR

PSAIYVDYSSNNLNNSIPLDIGNSLALASFFSIANNSITGMIPESICNISYLQVLDLSNNKLSGTIPPCLLHNSTSLGVLNLGNNRLHGVIPDSFPIGCALKTLDLSRNTFEGKLPKSLVNCTLLEVLNVGNNRLVDRFPCMLSNSNSLSVLVLRSNQFNGNLTCDITTNSWQDLQIIDIASNRFTGVLNPECFSNWRGMIVAHDNVETAHNHIQYKFLQLSNFYYQDTVTLTIKGMELELVKILRVFTSIDFSSNRFHGMIPDTVGDLSSLYLLNLSYNALEGPIPKSVGKLQMLESLDLSTNHLSGEIPSELASLTFLAALNVSFNNLFGKIPQGIQLQTFSGDSFEGNRGLCGFPLSNSC

HMMPfam: PF13855
653-707 LRR_8,Leucine rich repeat

IANNSITGMIPESICNISYLQVLDLSNNKLSGTIPPCLLHNSTSLGVLNLGNNRL

FPrintScan: PR00019
669-682 LEURICHRPT,Leucine-rich repeat signature

ISYLQVLDLSNNKL

Gene3D: G3DSA:3.80.10.10
721-980 G3DSA:3.80.10.10

LKTLDLSRNTFEGKLPKSLVNCTLLEVLNVGNNRLVDRFPCMLSNSNSLSVLVLRSNQFNGNLTCDITTNSWQDLQIIDIASNRFTGVLNPECFSNWRGMIVAHDNVETAHNHIQYKFLQLSNFYYQDTVTLTIKGMELELVKILRVFTSIDFSSNRFHGMIPDTVGDLSSLYLLNLSYNALEGPIPKSVGKLQMLESLDLSTNHLSGEIPSELASLTFLAALNVSFNNLFGKIPQGIQLQTFSGDSFEGNRGLCGFPLS

HMMPfam: PF13855
721-778 LRR_8,Leucine rich repeat

LKTLDLSRNTFEGKLPKSLVNCTLLEVLNVGNNRLVDRFPCMLSNSNSLSVLVLRSNQ

HMMPfam: PF00560
IPR001611
916-937 LRR_1
Leucine-rich repeat

LESLDLSTNHLSGEIPSELASL


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox