PRGDB00049015 (lrr1)

From PRG Wiki
Jump to: navigation, search
lrr1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 47457571 (AJ617668)
Gene Class Unknown
Domain Type LRR
Gene Species Populus tremula

Comment?

Populus tremula lrr1 gene for LRR disease resistance protein, isolate llr1_76-1.

DNA Sequence

ATGGGATCCTTAACTGAGTTGCTAGTTGATGGGATTGAAAATGAGCAATTTCTCTCTTCAATTGAACAATTAAAGCATGTTAGAAGGTTATCATTGCGTGGATACAGTTCGGCCCCACCAAGTTGTTCTTTGATTACAGCAAATGTTTTGAATTTGAAACGTTGGCTACCAACATCTTTTATTAAATGGATATCAGTGAAACGTCTTGAGCTTTCTAATGGTGGTTTGTCTGATCGCGTAATTAACTGTGTTGATTTCGGTAGTTTGTCCGCTCTAGAAGTATTGGATCTAAGTGGAAACAAATTCTCTAGTCGGCCTTCTGGGATCGGCTTCCTTCCCAAGCTATGGTGCTTGGGTGTTAAGACATGTGAATATCTTATATCAATCTCAGATCTTCCCTCAAGTTTATGCCTTTTTGGAAAGAGTAAGAATACCAATCGAGTAAAAAAAACAACTATGTATAAGTCTATATGGAAGTCATTCGCTAGAAAAGATTCAGGGCATCGAAGGTCTAAGTAA


Protein sequences

Name Description Sequence
putative LRR disease resistance protein putative LRR disease resistance protein [Populus tremula].

MGSLTELLVDGIENEQFLSSIEQLKHVRRLSLRGYSSAPPSCSLITANVLNLKRWLPTSFIKWISVKRLELSNGGLSDRVINCVDFGSLSALEVLDLSGNKFSSRPSGIGFLPKLWCLGVKTCEYLISISDLPSSLCLFGKSKNTNRVKKTTMYKSIWKSFARKDSGHRRSK

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.80.10.10
3-126 G3DSA:3.80.10.10

SLTELLVDGIENEQFLSSIEQLKHVRRLSLRGYSSAPPSCSLITANVLNLKRWLPTSFIKWISVKRLELSNGGLSDRVINCVDFGSLSALEVLDLSGNKFSSRPSGIGFLPKLWCLGVKTCEYL

superfamily: SSF52058
16-131 SSF52058,LRR

QFLSSIEQLKHVRRLSLRGYSSAPPSCSLITANVLNLKRWLPTSFIKWISVKRLELSNGGLSDRVINCVDFGSLSALEVLDLSGNKFSSRPSGIGFLPKLWCLGVKTCEYLISISD






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox