PRGDB00049045 (llr1)

From PRG Wiki
Jump to: navigation, search
llr1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 47457511 (AJ617638)
Gene Class Unknown
Domain Type LRR
Gene Species Populus alba

Comment?

Populus alba lrr1 gene for LRR disease resistance protein, isolate Palba1.

DNA Sequence

ATGGAATCCTTAACTGAGCTGCTAGCCGATGGGATTGAAAATGAGCAATTTCTCTCTTCAATTGGACAATTAAAGCATGTCAGAAGGTTATCATTGCGTGGATACAGTTCGGCTCCACCAAGTTCTTCTTTGATTTCAGCAAGTGTTTCGAATTTGAAACGTTGGCTACCAATATCTTTCATTGAATGGATATCAGTGAAACGTCTTGAGCTTCCTCATGGTGGTTTGTCTGATCGCGCAACTAAATGTGTTGAAGGTTTGTCCTCTCTAGAAGTATTGCATCTAAGAGGAAACAAATTCTCTAGCCTGCCTTCTGGGATCGGCCTCCTTCCCAAGCTAACGTATTTGTCTGTTCAGGCATGCAAATATCTTGTATCAATCCCAGATCTTCCCTCAAGTTTAGAGTGTTTGGGTGCATCTCATTGCGAATCATTGAAAAGAGTAAGAATACCAATCGAGTAA


Protein sequences

Name Description Sequence
putative LRR disease resistance protein putative LRR disease resistance protein [Populus alba].

MESLTELLADGIENEQFLSSIGQLKHVRRLSLRGYSSAPPSSSLISASVSNLKRWLPISFIEWISVKRLELPHGGLSDRATKCVEGLSSLEVLHLRGNKFSSLPSGIGLLPKLTYLSVQACKYLVSIPDLPSSLECLGASHCESLKRVRIPIE


Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.80.10.10
3-138 G3DSA:3.80.10.10

SLTELLADGIENEQFLSSIGQLKHVRRLSLRGYSSAPPSSSLISASVSNLKRWLPISFIEWISVKRLELPHGGLSDRATKCVEGLSSLEVLHLRGNKFSSLPSGIGLLPKLTYLSVQACKYLVSIPDLPSSLECLG

superfamily: SSF52058
16-148 SSF52058,LRR

QFLSSIGQLKHVRRLSLRGYSSAPPSSSLISASVSNLKRWLPISFIEWISVKRLELPHGGLSDRATKCVEGLSSLEVLHLRGNKFSSLPSGIGLLPKLTYLSVQACKYLVSIPDLPSSLECLGASHCESLKRV

HMMSmart: SM00369
IPR003591
87-110 LRR_TYP
Leucine-rich repeat, typical subtype

LSSLEVLHLRGNKFSSLPSGIGLL

HMMPfam: PF12799
89-131 LRR_4,Leucine Rich repeats (2 copies)

SLEVLHLRGNKFSSLPSGIGLLPKLTYLSVQACKYLVSIPDLP

ProfileScan: PS51450
IPR001611
89-110 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLEVLHLRGNKFSSLPSGIGLL

ProfileScan: PS51450
IPR001611
112-134 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLTYLSVQACKYLVSIPDLPSSL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox