PRGDB00049046 (lrr1)

From PRG Wiki
Jump to: navigation, search
lrr1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 47457509 (AJ617637)
Gene Class Unknown
Domain Type LRR, Ser-Thr Kinase
Gene Species Populus tremula

Comment?

Populus tremula lrr1 gene for LRR disease resistance protein, isolate llr1_1-2.

DNA Sequence

ATGGAATCCTTAACTGAGTTGCTAGTTGATGGGATTGAAAATGAGCAATTTCTCTCTTCAATTGAACAATTAAAGCATGTTAGAAGGTTATCATTGCGTGGATACAGTTCGGCCCCACCAAGTTGTTCTTTGATTACAGCAAATGTTTTGAATTTGAAACGTTGGCTACCAACATCTTTTATTAAATGGATATCAGTGAAACGTCTTGAGCTTTCTAATGGTGGTTTGTCTGATCGCGTAATTAACTGTGTTGATTTCGGTAGTTTGTCCGCTCTAGAAGTATTGGATCTAAGTGGAAACAAATTCTCTAGTCTGCCTTCTGGGATCGGCTTCCTTCCCAAGCTATGGTGCTTGGGTGTTAAGACATGTGAATATCTTGTATCAATCTCAGATGTTCCCTCAAGTTTATGCTTTTTAGGTGCATCTTATTGCAAATCATTGGAAAGAGTAAGAATACCAATCGAGTAA


Protein sequences

Name Description Sequence
putative LRR disease resistance protein putative LRR disease resistance protein [Populus tremula].

MESLTELLVDGIENEQFLSSIEQLKHVRRLSLRGYSSAPPSCSLITANVLNLKRWLPTSFIKWISVKRLELSNGGLSDRVINCVDFGSLSALEVLDLSGNKFSSLPSGIGFLPKLWCLGVKTCEYLVSISDVPSSLCFLGASYCKSLERVRIPIE


Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.80.10.10
2-134 G3DSA:3.80.10.10

ESLTELLVDGIENEQFLSSIEQLKHVRRLSLRGYSSAPPSCSLITANVLNLKRWLPTSFIKWISVKRLELSNGGLSDRVINCVDFGSLSALEVLDLSGNKFSSLPSGIGFLPKLWCLGVKTCEYLVSISDVPS

superfamily: SSF52058
16-145 SSF52058,LRR

QFLSSIEQLKHVRRLSLRGYSSAPPSCSLITANVLNLKRWLPTSFIKWISVKRLELSNGGLSDRVINCVDFGSLSALEVLDLSGNKFSSLPSGIGFLPKLWCLGVKTCEYLVSISDVPSSLCFLGASYCK

HMMSmart: SM00369
IPR003591
89-112 LRR_TYP
Leucine-rich repeat, typical subtype

LSALEVLDLSGNKFSSLPSGIGFL

ProfileScan: PS51450
IPR001611
91-113 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALEVLDLSGNKFSSLPSGIGFLP






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox