PRGDB00049053 (verticillium wilt disease resistance protein)

From PRG Wiki
Jump to: navigation, search
verticillium wilt disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 49073107 (AY615303)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Solanum aethiopicum

Comment?

Solanum aethiopicum verticillium wilt disease resistance protein (Save1) mRNA, complete cds.

DNA Sequence

ATGAAAATGATGGCAACTCTGTACTTCCCTATGGTTCTCTTGATTCCCTCGTTACAAATCTTATCAGGATACCACATTTTCTTGGTTTCCTCTCAATGCCTTGACGATCAAAAGTCATTGTTGCTGCAGTTTAAGGGAAGCCTCCAATATGATTCTACTTTGTCAAAGAAATTGGCAAAATGGAACGACATGACAAGTGAATGTTGCAATTGGAATGGGGTTACATGCAATCTCTTTGGTCATGTCATCGCTTTGGAACTGGATGATGAGACTATTTCTAGTGGAATTGAGAATTCTAGTGCACTTTTCAGTCTTCAATATCTTGAGAGCCTAAATTTGGCTGACAACATGTTCAATGTTGGCATACCAGTTGGTATAGACAACCTCACAAACTTGAAGTACCTGAATTTATCCAATGCTGGTTTTGTCGGGCAAATTCCTATAACATTATCAAGATTAACAAGGCTAGTTACTCTTGATCTCTCAACTATTCTCCCTTTTTTTGATCAGCCACTTAAACTTGAGAATCCCAATTTGAGTCATTTCATTGAGAACTCAACAGAGCTTAGAGAGCTTTACCTTGATGGGGTTGATCTTTCGTCTCAGAGGTCTGAGTGGTGTCAATCTTTATCTTTACATTTGCCTAACTTGACCGTTTTGAGCTTGCGTGATTGTCAAATTTCAGGCCCTTTGGATGAATCACTTACTAAGCTTCACTTTCTCTCTTTTGTCCAACTTGACCAGAACAATCTCTCTAGCACAGTTCCTGAATATTTTGCCAATTTCTCGAACTTGACTACATTTGACCCTGGGCTCTGTAATCTGCAGGGAACATTTCCAGAAAGAATCTTTCAGGTATCAGTTTTAGAGATTTTGGACTTGTCAAATAACAAGTTGCTTAGTGGTAGTATTCCGAATTTTCCTCGATATGGATCTTTGAGGAGGATATTGCTAAGCTACACCAACTTTTCTGGTTCATTACCAGACTCCATTTCGAACCTTCAGAATCTGTCCAGGTTAGAGCTCTCCTATTGCAATTTCAATGGACCAATACCCTCCACCATGGCAAACCTTACCAATCTTGTTTATTTAGATTTCTCCTCCAATAACTTCACTGGTTTTATACCATATTTCCAACGGTCCAAGAAACTCACCTACTTAGACCTTTCACGTAATGGTCTAACTGGTCTCTTCTCTAGAGCTCATTCTGAAGGACTCTCAGAGTTCGTCTACATGAATTTAGGGAACAATTCACTCAACGGGATCCTTCCTGCAGAAATATTTGAGCTCCCCTCCTTGCAGCAGCTCTTTCTTAACAGCAATCAATTTGTTGGCCAAGTCGACGAGTTACGCAATGCATCCTCCTCTCCGTTAGATATAATCGATTTGAGCAACAACCACCTGAATGGTTCAATTCCCAATTCCATGTTTGAAGTTAGGAGGCTTAAGGTCCTCTCACTTTCTTCCAACTTCTTTAGTGGGACAGTGCCCCTTGACCGCATTGGGAAGCTGAGCAACCTTTCAAGACTGGAGCTTTCTTACAATAACTTGACTGTTGATGCAAGTAGCAGCAATTCAACCTCTTTCACATTTCCCCAGCTGACTATATTGAAATTGGCTTCTTGTCGGCTGCAAAAGTTCCCTGATCTCAAGAATCAGTCAAGGATGATCCACTTAGACCTTTCAAACAACCAAATACGGGGGGCAATACCAAATTGGATCTGGGGAATTGGTGGTGGAGGTCTCACCCACCTGAATCTTTCATTCAATCAGCTGGAGTACGTGGAACAGCCTTACACTGCTTCCAGCAATCTTGTAGTCCTTGATTTGCATTCCAACCGTTTAAAAGGTGACTTACTAATACCACCTTGCACTGCCATCTATGTGAACTACTCTAGCAATAATTTAAACAATTCCATCCCAACAGATATTGGAAAGTCTCTTGGTTTTGCCTCCTTTTTCTCGGTAGCAAACAATGGCATTACTGGAATAATTCCTGAATCCATATGCAACTGCAGCTACCTTCAAGTTCTTGATTTCTCTAACAATGCCTTGAGTGGAACAATACCACCATGTCTACTGGAATATAGTACAAAACTTGGAGTGCTGAATCTTGGGAACAATAAACTCAATGGTGTTATACCAGATTCATTTTCAATTGGTTGTGCTCTACAAACATTAGACCTCAGTGCGAATAACTTACAAGGCAGGCTGCCAAAATCGATTGTGAATTGTAAGTTGTTGGAGGTCCTGAATGTTGGAAATAACAAACTTGTTGATCACTTCCCATGCATGTTGAGGAACTCGAACAGTCTGAGGGTCCTAGTCCTGCGCTCCAATCAATTCAATGGAAATCTTACATGTGATATAACCACAAATAGCTGGCAGAATCTCCAGATCATAGATATTGCTTCCAACAGTTTTACTGGCGTTTTGAATGCAGGATGCTTTTCTAATTGGAGAGGAATGATGGTTGCACATGATTACGTGGAGACAGGACGCAATCATATCCAATATAAGTTCTTCCAACTAAGTAACTTTTACTATCAGGACACAGTGACATTAACCATCAAAGGCATGGAGCTGGAGCTTGTGAAGATTCTCAGGGTCTTCACATCTATTGATTTCTCTTCAAATAGATTTCAAGGAGTGATACCAAATACGGTTGGGGATCTTAGCTCGCTTTATGTTCTGAACCTGTCACACAATGCCCTTGAGGGACCAATTCCAAAATCAATCGGTAAGCTACAAATGCTTGAATCACTAGACCTGTCAACAAACCACCTGTCCGGAGAGATCCCCTCAGAGCTTGCAAGTCTCACATTCTTAGCAGCTTTGATCTTATCATTCAACAATTTGTTTGGCAAAATCCCATCAACTAATCAATTTCTAACATTCTCAGCAGATTCCTTTGAAGGAAACAGAGGCCTCTGTGGGCTCCCTCTCAACAACAGTTGCGAAAGCAAGAGATCAGAGTTCATGCCGCTGCAAACTTCGCTACCAGAGTCAGATTTTGAATGGGAGTTCATTTTCGCGGCTGTTGGATACATAGTAGGGGCAGCAAATACTATTTCAGTTGTGTGGTTTTACAAGCCAGTGAAGAAATGGTTTGATAAGCATATGGAGAAATGCTTGCTTTGGTTTACAAGAAAGTGA


Protein sequences

Name Description Sequence
verticillium wilt disease resistance protein verticillium wilt disease resistance protein [Solanum aethiopicum].

MKMMATLYFPMVLLIPSLQILSGYHIFLVSSQCLDDQKSLLLQFKGSLQYDSTLSKKLAKWNDMTSECCNWNGVTCNLFGHVIALELDDETISSGIENSSALFSLQYLESLNLADNMFNVGIPVGIDNLTNLKYLNLSNAGFVGQIPITLSRLTRLVTLDLSTILPFFDQPLKLENPNLSHFIENSTELRELYLDGVDLSSQRSEWCQSLSLHLPNLTVLSLRDCQISGPLDESLTKLHFLSFVQLDQNNLSSTVPEYFANFSNLTTFDPGLCNLQGTFPERIFQVSVLEILDLSNNKLLSGSIPNFPRYGSLRRILLSYTNFSGSLPDSISNLQNLSRLELSYCNFNGPIPSTMANLTNLVYLDFSSNNFTGFIPYFQRSKKLTYLDLSRNGLTGLFSRAHSEGLSEFVYMNLGNNSLNGILPAEIFELPSLQQLFLNSNQFVGQVDELRNASSSPLDIIDLSNNHLNGSIPNSMFEVRRLKVLSLSSNFFSGTVPLDRIGKLSNLSRLELSYNNLTVDASSSNSTSFTFPQLTILKLASCRLQKFPDLKNQSRMIHLDLSNNQIRGAIPNWIWGIGGGGLTHLNLSFNQLEYVEQPYTASSNLVVLDLHSNRLKGDLLIPPCTAIYVNYSSNNLNNSIPTDIGKSLGFASFFSVANNGITGIIPESICNCSYLQVLDFSNNALSGTIPPCLLEYSTKLGVLNLGNNKLNGVIPDSFSIGCALQTLDLSANNLQGRLPKSIVNCKLLEVLNVGNNKLVDHFPCMLRNSNSLRVLVLRSNQFNGNLTCDITTNSWQNLQIIDIASNSFTGVLNAGCFSNWRGMMVAHDYVETGRNHIQYKFFQLSNFYYQDTVTLTIKGMELELVKILRVFTSIDFSSNRFQGVIPNTVGDLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSTNHLSGEIPSELASLTFLAALILSFNNLFGKIPSTNQFLTFSADSFEGNRGLCGLPLNNSCESKRSEFMPLQTSLPESDFEWEFIFAAVGYIVGAANTISVVWFYKPVKKWFDKHMEKCLLWFTRK


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-1021 PTHR24420,FAMILY NOT NAMED

MKMMATLYFPMVLLIPSLQILSGYHIFLVSSQCLDDQKSLLLQFKGSLQYDSTLSKKLAKWNDMTSECCNWNGVTCNLFGHVIALELDDETISSGIENSSALFSLQYLESLNLADNMFNVGIPVGIDNLTNLKYLNLSNAGFVGQIPITLSRLTRLVTLDLSTILPFFDQPLKLENPNLSHFIENSTELRELYLDGVDLSSQRSEWCQSLSLHLPNLTVLSLRDCQISGPLDESLTKLHFLSFVQLDQNNLSSTVPEYFANFSNLTTFDPGLCNLQGTFPERIFQVSVLEILDLSNNKLLSGSIPNFPRYGSLRRILLSYTNFSGSLPDSISNLQNLSRLELSYCNFNGPIPSTMANLTNLVYLDFSSNNFTGFIPYFQRSKKLTYLDLSRNGLTGLFSRAHSEGLSEFVYMNLGNNSLNGILPAEIFELPSLQQLFLNSNQFVGQVDELRNASSSPLDIIDLSNNHLNGSIPNSMFEVRRLKVLSLSSNFFSGTVPLDRIGKLSNLSRLELSYNNLTVDASSSNSTSFTFPQLTILKLASCRLQKFPDLKNQSRMIHLDLSNNQIRGAIPNWIWGIGGGGLTHLNLSFNQLEYVEQPYTASSNLVVLDLHSNRLKGDLLIPPCTAIYVNYSSNNLNNSIPTDIGKSLGFASFFSVANNGITGIIPESICNCSYLQVLDFSNNALSGTIPPCLLEYSTKLGVLNLGNNKLNGVIPDSFSIGCALQTLDLSANNLQGRLPKSIVNCKLLEVLNVGNNKLVDHFPCMLRNSNSLRVLVLRSNQFNGNLTCDITTNSWQNLQIIDIASNSFTGVLNAGCFSNWRGMMVAHDYVETGRNHIQYKFFQLSNFYYQDTVTLTIKGMELELVKILRVFTSIDFSSNRFQGVIPNTVGDLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSTNHLSGEIPSELASLTFLAALILSFNNLFGKIPSTNQFLTFSADSFEGNRGLCGLPLNNSCESKRSEFMPLQTSLPESDFEWEFIFAAVGYIVGAA

HMMPanther: PTHR24420:SF473
1-1021 PTHR24420:SF473,SUBFAMILY NOT NAMED

MKMMATLYFPMVLLIPSLQILSGYHIFLVSSQCLDDQKSLLLQFKGSLQYDSTLSKKLAKWNDMTSECCNWNGVTCNLFGHVIALELDDETISSGIENSSALFSLQYLESLNLADNMFNVGIPVGIDNLTNLKYLNLSNAGFVGQIPITLSRLTRLVTLDLSTILPFFDQPLKLENPNLSHFIENSTELRELYLDGVDLSSQRSEWCQSLSLHLPNLTVLSLRDCQISGPLDESLTKLHFLSFVQLDQNNLSSTVPEYFANFSNLTTFDPGLCNLQGTFPERIFQVSVLEILDLSNNKLLSGSIPNFPRYGSLRRILLSYTNFSGSLPDSISNLQNLSRLELSYCNFNGPIPSTMANLTNLVYLDFSSNNFTGFIPYFQRSKKLTYLDLSRNGLTGLFSRAHSEGLSEFVYMNLGNNSLNGILPAEIFELPSLQQLFLNSNQFVGQVDELRNASSSPLDIIDLSNNHLNGSIPNSMFEVRRLKVLSLSSNFFSGTVPLDRIGKLSNLSRLELSYNNLTVDASSSNSTSFTFPQLTILKLASCRLQKFPDLKNQSRMIHLDLSNNQIRGAIPNWIWGIGGGGLTHLNLSFNQLEYVEQPYTASSNLVVLDLHSNRLKGDLLIPPCTAIYVNYSSNNLNNSIPTDIGKSLGFASFFSVANNGITGIIPESICNCSYLQVLDFSNNALSGTIPPCLLEYSTKLGVLNLGNNKLNGVIPDSFSIGCALQTLDLSANNLQGRLPKSIVNCKLLEVLNVGNNKLVDHFPCMLRNSNSLRVLVLRSNQFNGNLTCDITTNSWQNLQIIDIASNSFTGVLNAGCFSNWRGMMVAHDYVETGRNHIQYKFFQLSNFYYQDTVTLTIKGMELELVKILRVFTSIDFSSNRFQGVIPNTVGDLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSTNHLSGEIPSELASLTFLAALILSFNNLFGKIPSTNQFLTFSADSFEGNRGLCGLPLNNSCESKRSEFMPLQTSLPESDFEWEFIFAAVGYIVGAA

Gene3D: G3DSA:3.80.10.10
32-304 G3DSA:3.80.10.10

QCLDDQKSLLLQFKGSLQYDSTLSKKLAKWNDMTSECCNWNGVTCNLFGHVIALELDDETISSGIENSSALFSLQYLESLNLADNMFNVGIPVGIDNLTNLKYLNLSNAGFVGQIPITLSRLTRLVTLDLSTILPFFDQPLKLENPNLSHFIENSTELRELYLDGVDLSSQRSEWCQSLSLHLPNLTVLSLRDCQISGPLDESLTKLHFLSFVQLDQNNLSSTVPEYFANFSNLTTFDPGLCNLQGTFPERIFQVSVLEILDLSNNKLLSGSI

HMMPfam: PF08263
IPR013210
35-77 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

DDQKSLLLQFKGSLQYDSTLSKKLAKWNDMTSECCNWNGVTCN

superfamily: SSF52047
84-408 SSF52047,LRR

ALELDDETISSGIENSSALFSLQYLESLNLADNMFNVGIPVGIDNLTNLKYLNLSNAGFVGQIPITLSRLTRLVTLDLSTILPFFDQPLKLENPNLSHFIENSTELRELYLDGVDLSSQRSEWCQSLSLHLPNLTVLSLRDCQISGPLDESLTKLHFLSFVQLDQNNLSSTVPEYFANFSNLTTFDPGLCNLQGTFPERIFQVSVLEILDLSNNKLLSGSIPNFPRYGSLRRILLSYTNFSGSLPDSISNLQNLSRLELSYCNFNGPIPSTMANLTNLVYLDFSSNNFTGFIPYFQRSKKLTYLDLSRNGLTGLFSRAHSEGLSE

HMMPfam: PF13516
214-229 LRR_6,Leucine Rich repeat

LPNLTVLSLRDCQISG

HMMPfam: PF00560
IPR001611
289-307 LRR_1
Leucine-rich repeat

LEILDLSNNKLLSGSIPNF

Gene3D: G3DSA:3.80.10.10
305-537 G3DSA:3.80.10.10

PNFPRYGSLRRILLSYTNFSGSLPDSISNLQNLSRLELSYCNFNGPIPSTMANLTNLVYLDFSSNNFTGFIPYFQRSKKLTYLDLSRNGLTGLFSRAHSEGLSEFVYMNLGNNSLNGILPAEIFELPSLQQLFLNSNQFVGQVDELRNASSSPLDIIDLSNNHLNGSIPNSMFEVRRLKVLSLSSNFFSGTVPLDRIGKLSNLSRLELSYNNLTVDASSSNSTSFTFPQLTIL

HMMPfam: PF00560
IPR001611
360-379 LRR_1
Leucine-rich repeat

NLVYLDFSSNNFTGFIPYFQ

HMMPfam: PF13855
383-442 LRR_8,Leucine rich repeat

KLTYLDLSRNGLTGLFSRAHSEGLSEFVYMNLGNNSLNGILPAEIFELPSLQQLFLNSNQ

FPrintScan: PR00019
384-397 LEURICHRPT,Leucine-rich repeat signature

LTYLDLSRNGLTGL

superfamily: SSF52058
405-618 SSF52058,LRR

GLSEFVYMNLGNNSLNGILPAEIFELPSLQQLFLNSNQFVGQVDELRNASSSPLDIIDLSNNHLNGSIPNSMFEVRRLKVLSLSSNFFSGTVPLDRIGKLSNLSRLELSYNNLTVDASSSNSTSFTFPQLTILKLASCRLQKFPDLKNQSRMIHLDLSNNQIRGAIPNWIWGIGGGGLTHLNLSFNQLEYVEQPYTASSNLVVLDLHSNRLKGD

HMMPfam: PF00560
IPR001611
458-478 LRR_1
Leucine-rich repeat

LDIIDLSNNHLNGSIPNSMFE

Gene3D: G3DSA:3.80.10.10
538-619 G3DSA:3.80.10.10

KLASCRLQKFPDLKNQSRMIHLDLSNNQIRGAIPNWIWGIGGGGLTHLNLSFNQLEYVEQPYTASSNLVVLDLHSNRLKGDL

HMMPfam: PF00560
IPR001611
557-574 LRR_1
Leucine-rich repeat

IHLDLSNNQIRGAIPNWI

superfamily: SSF52058
624-986 SSF52058,LRR

CTAIYVNYSSNNLNNSIPTDIGKSLGFASFFSVANNGITGIIPESICNCSYLQVLDFSNNALSGTIPPCLLEYSTKLGVLNLGNNKLNGVIPDSFSIGCALQTLDLSANNLQGRLPKSIVNCKLLEVLNVGNNKLVDHFPCMLRNSNSLRVLVLRSNQFNGNLTCDITTNSWQNLQIIDIASNSFTGVLNAGCFSNWRGMMVAHDYVETGRNHIQYKFFQLSNFYYQDTVTLTIKGMELELVKILRVFTSIDFSSNRFQGVIPNTVGDLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSTNHLSGEIPSELASLTFLAALILSFNNLFGKIPSTNQFLTFSADSFEGNRGLCGLPLNNSC

Gene3D: G3DSA:3.80.10.10
632-800 G3DSA:3.80.10.10

SSNNLNNSIPTDIGKSLGFASFFSVANNGITGIIPESICNCSYLQVLDFSNNALSGTIPPCLLEYSTKLGVLNLGNNKLNGVIPDSFSIGCALQTLDLSANNLQGRLPKSIVNCKLLEVLNVGNNKLVDHFPCMLRNSNSLRVLVLRSNQFNGNLTCDITTNSWQNLQI

HMMPfam: PF13855
656-710 LRR_8,Leucine rich repeat

VANNGITGIIPESICNCSYLQVLDFSNNALSGTIPPCLLEYSTKLGVLNLGNNKL

HMMPfam: PF13855
724-781 LRR_8,Leucine rich repeat

LQTLDLSANNLQGRLPKSIVNCKLLEVLNVGNNKLVDHFPCMLRNSNSLRVLVLRSNQ

HMMPfam: PF13855
873-929 LRR_8,Leucine rich repeat

SIDFSSNRFQGVIPNTVGDLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSTNHL

Gene3D: G3DSA:3.80.10.10
874-983 G3DSA:3.80.10.10

IDFSSNRFQGVIPNTVGDLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSTNHLSGEIPSELASLTFLAALILSFNNLFGKIPSTNQFLTFSADSFEGNRGLCGLPLN

FPrintScan: PR00019
892-905 LEURICHRPT,Leucine-rich repeat signature

LSSLYVLNLSHNAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox