PRGDB00049055 (disease resistance protein SlVe2 precursor)

From PRG Wiki
Jump to: navigation, search
disease resistance protein SlVe2 precursor
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 33439499 (AY282580)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Solanum lycopersicoides

Comment?

Solanum lycopersicoides disease resistance protein SlVe2 precursor, gene, complete cds.

DNA Sequence

ATGAGATTTTTACACTTCCTATGGATCTTCTTGATACCCTTTTTGCAAATTTTATTAGGTAATGAGATTTTACTGGTTTCCTCTCAATGTCTTGATGATCAAAAGTCATTGTTGCTGCAGTTGAAGGGCAGCTTCCAATATGATTCTACTTTGTCAAATAAATTGGAAAGATGGAACCACAACACAAGTGAATGTTGCAATTGGAATGGGGTTACATGTGACCTCTCTGGTCATGTGATTGCCTTGGAACTGGATGATGAGAAAATTTCTAGTGGAATTGAGAATGCAAGTGCTCTTTTCAGTCTTCAGTATCTTGAGAGCCTAAATTTGGCTTACAACAAGTTCAAAGTTGGCATACCAGTTGGTATAGGCAACCTCACCAACTTGAAGTACCTGAATTTATCCAATGCCGGTTTTGTTGGTCAAATTCCTATGATGTTATCAAGGTTAACAAGGCTAGTTACTCTTGATCTCTCAACTCTTTTCCCTGACTTTGACCAGCCACTAAAACTTGAGAATCCCAATTTGAGTCATTTCATTGAGAACTCAACAGAGCTTAGAGAGCTTTACCTTGATGGGGTTGATCTTTCAGCTCAGAGTACTGAATGGTGTCAATCTTTATCTTCATATTTGCCTAACTTAACCGTCTTGAGCTTGCGTGATTGTCGAATTTCAGACCCTATTCATGAATCACTTTCTAAGCTTCACTTTCTCTCTTTCATCCGTCTTGACCAGAACAATCTCTCTACCACAGTTCCAGAATATTTTGCCAATTTCTCGAGCATGACTACCTTGAACCTTGCCTCGTGTAATTTGCAAGGAACATTTCCTGAAAGAATATTTCAGGTATCAGTTTTAGATAGTTTGGACTTGTCAACTAACAAGTTGCTTCGTGGTAGCATTCCAATTTTTCTTCAAAATGGATCTTTGAGGATATTATCACTAAGCTACACCAACTTTTTTGGTTCATTACCAGAGTCCATTTCGAACCTTCAGAACCTGTCAAGGTTAGAGCTTTCCAATTGCAATTTCAATGGATCAATACCTTCCACAATGGCAAACCTTATCAATCTTGGTTATTTGGACTTATCCTTCAACAATTTCACTGGTTCTATCCCATATTTTCAACGGTCCAAGAAACTCACCTACTTAGACCTTTCACGTAATGGTCTAACTGGTCTCTTGTCTAGAGCTCATTTTGAAGGACTCTCAGAGCTTGTCTACATAAATTTAGGGGACAATTCACTCAACGGGACCCTTCCTGCATATATATTTGAGCTCCCCTCCTTGCAGAAGCTTTTTCTTAACAACAATCAATTTGTTGGTCAAGTCGACGAATTCCGCAATGCATACTCCTCTCTGTTGGATACAGTTGATCTAAGAAACAACCACCTGAATGGATCGATTCCCAAGTCCACATTTGAAATTGGCAGGCTTAAGGTCCTCTCACTTTCTTCAAACTTCTTTAGCGGGACAGTGACCCTTGATCTCATTGGGAGGCTGAACAACCTTTCAGTACTGGAGCTTTCTTACAATAACTTGACTGTTGATGCAAGTAGCAGCAATTCAACCTCTTTCACATTTCCGCAGTTGAGCATATTGAAATTAGCTTCTTGTCGGTTGCAAAAGTTCCCTGATCTCATGAATCAGTCAAGGATGTTCCACTTAGACCTTTCAGACAACCAAATACGGGGGGCAATACCAAATTGGATTTGGGGAATTGGTGGTGGAGGTTTGACTCACCTGAATCTTTCCTTCAATCAGCTGGAGTACGTGGAACAGCCTTACAATGCTTCCAGCAATCTTTTTGTCCTTGACTTGCACTCCAACCGTTTGAAAGGTGACTTACCAATTCCGCCTTCCTCTGCCATCTATGTGGACTATTCGAGCAATAATTTAAACAATTCCATCCCACTAGATATTGGAAATTCTATTTTTCTTGCCTCCTTTTTCTCGGTAGCAAACAATAGCATCACTGGAGTAATTCCTGAATCCATATGCAATGTCAGCTACCTTCAAGTTCTTGATTTCTCTAACAATGCCTTGAGTGGAACAATACCACCATGTCTATTGGAATATAGTACAACTCTTGGAGTGCTGAATCTAGGGAACAATAGACTCCATGGTGTTATACCAGATTCATTTCCAATTGGTTGTGCTCTAAAAACTTTAGACCTCAGTAGGAATACCTTTGAAGGGAAGCTACCAAAATCGCTTGTCAACTGCATGTTCTTGGAGGTTCTGAATGTTGGAAATAACAGTCTTGTTGATCGTTTCCCATGCATGTTGAGGAACTCAACCAGTCTGAGGGTCCTAGTCCTGCGCTCCAATCAATTCAATGGAAATCTTACATGTAATGTAACTACAAATAGCTGGCAGAATCTCCAGATCATAGATATAGCTTCCAACAGTTTTACTGGTATGTTGAATGCAGAATGCTTTTCAAAGTGGAGAGGAATGATGGTTGCAGATGATTACGTGGAGACAGGACGCAATCATATCCAGTATAAGTTCCTCCAATTAAGTAACCTGTACTATCAGGACACAGTGACATTAACCATCAAAGGCATGGAGCTGGAGCTTGTGAAGATTCTCAGGGTCTTCACATCTATTGATTTCTCTTCAAATAGGTTTCAGGGAAAGATACCAGATACTGTTGGGGATCTTAGCTCACTTTATGTTTTGAACCTGTCACACAATGCCCTCGAGGGACCAATTCCAAAATCAATTGGGAAGCTACAAATGCTTGAATCACTAGACCTGTCAAGAAACCACCTGTCCGGGGAGATCCCCACAGAGCTTTCAAGTCTCACATTCTTAGCAGCTTTGAATTTATCGTTCAACAACTTTTTTGGCAAAATCCCGCGAAGTAATCAACTTTTCACATTCTCAGCAGATTCCTTTGAAGGAAACAGAGGCCTATGCGGGCTCCCTCTTAACGTCACTTGCAAAAGCGATACTCCAGAGTTGAAACCAGCACCAAGTTTTCAAGATGACTCTTATGATTGGCAGTTCATATTTACGGGTGTGGGATATGGAGTAGGGGCAGCAATCTCCATTGCACCTCTGTTGTTTTACAAGCAAGGAAACAAATACTTTGACAAACATTTGGAGAGAATGCTTAAACTGATGTTTCCAAGATACGGGTTCAGTTACACCAGATTTGACCCTGGGAAGGTTGTAGCCGTGGAACACTATGAAGATGAGACCCCAGATGACACCGAAGATGACGATGAGGGGGGAAAAGAAGCACCTCTTGGGCGTTATTGTGTCTTCTGTAGTAAACTTGATTTTCAGAAAAAGGAAGCAATGCATGATCCAAAATGCACTTGTCATATGTCATCATCCCCCAATTCTTTTCCTCCTACACCATCCTCTTCTTCACCTTTATTAGTCATATATCACAAAAAGTTTTGA


Protein sequences

Name Description Sequence
disease resistance protein SlVe2 precursor disease resistance protein SlVe2 precursor [Solanum lycopersicoides].

MRFLHFLWIFLIPFLQILLGNEILLVSSQCLDDQKSLLLQLKGSFQYDSTLSNKLERWNHNTSECCNWNGVTCDLSGHVIALELDDEKISSGIENASALFSLQYLESLNLAYNKFKVGIPVGIGNLTNLKYLNLSNAGFVGQIPMMLSRLTRLVTLDLSTLFPDFDQPLKLENPNLSHFIENSTELRELYLDGVDLSAQSTEWCQSLSSYLPNLTVLSLRDCRISDPIHESLSKLHFLSFIRLDQNNLSTTVPEYFANFSSMTTLNLASCNLQGTFPERIFQVSVLDSLDLSTNKLLRGSIPIFLQNGSLRILSLSYTNFFGSLPESISNLQNLSRLELSNCNFNGSIPSTMANLINLGYLDLSFNNFTGSIPYFQRSKKLTYLDLSRNGLTGLLSRAHFEGLSELVYINLGDNSLNGTLPAYIFELPSLQKLFLNNNQFVGQVDEFRNAYSSLLDTVDLRNNHLNGSIPKSTFEIGRLKVLSLSSNFFSGTVTLDLIGRLNNLSVLELSYNNLTVDASSSNSTSFTFPQLSILKLASCRLQKFPDLMNQSRMFHLDLSDNQIRGAIPNWIWGIGGGGLTHLNLSFNQLEYVEQPYNASSNLFVLDLHSNRLKGDLPIPPSSAIYVDYSSNNLNNSIPLDIGNSIFLASFFSVANNSITGVIPESICNVSYLQVLDFSNNALSGTIPPCLLEYSTTLGVLNLGNNRLHGVIPDSFPIGCALKTLDLSRNTFEGKLPKSLVNCMFLEVLNVGNNSLVDRFPCMLRNSTSLRVLVLRSNQFNGNLTCNVTTNSWQNLQIIDIASNSFTGMLNAECFSKWRGMMVADDYVETGRNHIQYKFLQLSNLYYQDTVTLTIKGMELELVKILRVFTSIDFSSNRFQGKIPDTVGDLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSRNHLSGEIPTELSSLTFLAALNLSFNNFFGKIPRSNQLFTFSADSFEGNRGLCGLPLNVTCKSDTPELKPAPSFQDDSYDWQFIFTGVGYGVGAAISIAPLLFYKQGNKYFDKHLERMLKLMFPRYGFSYTRFDPGKVVAVEHYEDETPDDTEDDDEGGKEAPLGRYCVFCSKLDFQKKEAMHDPKCTCHMSSSPNSFPPTPSSSSPLLVIYHKKF


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF473
4-983 PTHR24420:SF473,SUBFAMILY NOT NAMED

LHFLWIFLIPFLQILLGNEILLVSSQCLDDQKSLLLQLKGSFQYDSTLSNKLERWNHNTSECCNWNGVTCDLSGHVIALELDDEKISSGIENASALFSLQYLESLNLAYNKFKVGIPVGIGNLTNLKYLNLSNAGFVGQIPMMLSRLTRLVTLDLSTLFPDFDQPLKLENPNLSHFIENSTELRELYLDGVDLSAQSTEWCQSLSSYLPNLTVLSLRDCRISDPIHESLSKLHFLSFIRLDQNNLSTTVPEYFANFSSMTTLNLASCNLQGTFPERIFQVSVLDSLDLSTNKLLRGSIPIFLQNGSLRILSLSYTNFFGSLPESISNLQNLSRLELSNCNFNGSIPSTMANLINLGYLDLSFNNFTGSIPYFQRSKKLTYLDLSRNGLTGLLSRAHFEGLSELVYINLGDNSLNGTLPAYIFELPSLQKLFLNNNQFVGQVDEFRNAYSSLLDTVDLRNNHLNGSIPKSTFEIGRLKVLSLSSNFFSGTVTLDLIGRLNNLSVLELSYNNLTVDASSSNSTSFTFPQLSILKLASCRLQKFPDLMNQSRMFHLDLSDNQIRGAIPNWIWGIGGGGLTHLNLSFNQLEYVEQPYNASSNLFVLDLHSNRLKGDLPIPPSSAIYVDYSSNNLNNSIPLDIGNSIFLASFFSVANNSITGVIPESICNVSYLQVLDFSNNALSGTIPPCLLEYSTTLGVLNLGNNRLHGVIPDSFPIGCALKTLDLSRNTFEGKLPKSLVNCMFLEVLNVGNNSLVDRFPCMLRNSTSLRVLVLRSNQFNGNLTCNVTTNSWQNLQIIDIASNSFTGMLNAECFSKWRGMMVADDYVETGRNHIQYKFLQLSNLYYQDTVTLTIKGMELELVKILRVFTSIDFSSNRFQGKIPDTVGDLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSRNHLSGEIPTELSSLTFLAALNLSFNNFFGKIPRSNQLFTFSADSFEGNRGLCGLPLNVTC

HMMPanther: PTHR24420
4-983 PTHR24420,FAMILY NOT NAMED

LHFLWIFLIPFLQILLGNEILLVSSQCLDDQKSLLLQLKGSFQYDSTLSNKLERWNHNTSECCNWNGVTCDLSGHVIALELDDEKISSGIENASALFSLQYLESLNLAYNKFKVGIPVGIGNLTNLKYLNLSNAGFVGQIPMMLSRLTRLVTLDLSTLFPDFDQPLKLENPNLSHFIENSTELRELYLDGVDLSAQSTEWCQSLSSYLPNLTVLSLRDCRISDPIHESLSKLHFLSFIRLDQNNLSTTVPEYFANFSSMTTLNLASCNLQGTFPERIFQVSVLDSLDLSTNKLLRGSIPIFLQNGSLRILSLSYTNFFGSLPESISNLQNLSRLELSNCNFNGSIPSTMANLINLGYLDLSFNNFTGSIPYFQRSKKLTYLDLSRNGLTGLLSRAHFEGLSELVYINLGDNSLNGTLPAYIFELPSLQKLFLNNNQFVGQVDEFRNAYSSLLDTVDLRNNHLNGSIPKSTFEIGRLKVLSLSSNFFSGTVTLDLIGRLNNLSVLELSYNNLTVDASSSNSTSFTFPQLSILKLASCRLQKFPDLMNQSRMFHLDLSDNQIRGAIPNWIWGIGGGGLTHLNLSFNQLEYVEQPYNASSNLFVLDLHSNRLKGDLPIPPSSAIYVDYSSNNLNNSIPLDIGNSIFLASFFSVANNSITGVIPESICNVSYLQVLDFSNNALSGTIPPCLLEYSTTLGVLNLGNNRLHGVIPDSFPIGCALKTLDLSRNTFEGKLPKSLVNCMFLEVLNVGNNSLVDRFPCMLRNSTSLRVLVLRSNQFNGNLTCNVTTNSWQNLQIIDIASNSFTGMLNAECFSKWRGMMVADDYVETGRNHIQYKFLQLSNLYYQDTVTLTIKGMELELVKILRVFTSIDFSSNRFQGKIPDTVGDLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSRNHLSGEIPTELSSLTFLAALNLSFNNFFGKIPRSNQLFTFSADSFEGNRGLCGLPLNVTC

superfamily: SSF52058
28-299 SSF52058,LRR

SQCLDDQKSLLLQLKGSFQYDSTLSNKLERWNHNTSECCNWNGVTCDLSGHVIALELDDEKISSGIENASALFSLQYLESLNLAYNKFKVGIPVGIGNLTNLKYLNLSNAGFVGQIPMMLSRLTRLVTLDLSTLFPDFDQPLKLENPNLSHFIENSTELRELYLDGVDLSAQSTEWCQSLSSYLPNLTVLSLRDCRISDPIHESLSKLHFLSFIRLDQNNLSTTVPEYFANFSSMTTLNLASCNLQGTFPERIFQVSVLDSLDLSTNKLLRG

Gene3D: G3DSA:3.80.10.10
29-209 G3DSA:3.80.10.10

QCLDDQKSLLLQLKGSFQYDSTLSNKLERWNHNTSECCNWNGVTCDLSGHVIALELDDEKISSGIENASALFSLQYLESLNLAYNKFKVGIPVGIGNLTNLKYLNLSNAGFVGQIPMMLSRLTRLVTLDLSTLFPDFDQPLKLENPNLSHFIENSTELRELYLDGVDLSAQSTEWCQSLSS

HMMPfam: PF08263
IPR013210
32-74 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

DDQKSLLLQLKGSFQYDSTLSNKLERWNHNTSECCNWNGVTCD

HMMPfam: PF12799
104-137 LRR_4,Leucine Rich repeats (2 copies)

YLESLNLAYNKFKVGIPVGIGNLTNLKYLNLSNA

Gene3D: G3DSA:3.80.10.10
210-446 G3DSA:3.80.10.10

YLPNLTVLSLRDCRISDPIHESLSKLHFLSFIRLDQNNLSTTVPEYFANFSSMTTLNLASCNLQGTFPERIFQVSVLDSLDLSTNKLLRGSIPIFLQNGSLRILSLSYTNFFGSLPESISNLQNLSRLELSNCNFNGSIPSTMANLINLGYLDLSFNNFTGSIPYFQRSKKLTYLDLSRNGLTGLLSRAHFEGLSELVYINLGDNSLNGTLPAYIFELPSLQKLFLNNNQFVGQVDE

HMMPfam: PF00560
IPR001611
213-235 LRR_1
Leucine-rich repeat

NLTVLSLRDCRISDPIHESLSKL

superfamily: SSF52047
299-613 SSF52047,LRR

GSIPIFLQNGSLRILSLSYTNFFGSLPESISNLQNLSRLELSNCNFNGSIPSTMANLINLGYLDLSFNNFTGSIPYFQRSKKLTYLDLSRNGLTGLLSRAHFEGLSELVYINLGDNSLNGTLPAYIFELPSLQKLFLNNNQFVGQVDEFRNAYSSLLDTVDLRNNHLNGSIPKSTFEIGRLKVLSLSSNFFSGTVTLDLIGRLNNLSVLELSYNNLTVDASSSNSTSFTFPQLSILKLASCRLQKFPDLMNQSRMFHLDLSDNQIRGAIPNWIWGIGGGGLTHLNLSFNQLEYVEQPYNASSNLFVLDLHSNRLK

HMMPfam: PF00560
IPR001611
357-376 LRR_1
Leucine-rich repeat

NLGYLDLSFNNFTGSIPYFQ

HMMPfam: PF13855
380-439 LRR_8,Leucine rich repeat

KLTYLDLSRNGLTGLLSRAHFEGLSELVYINLGDNSLNGTLPAYIFELPSLQKLFLNNNQ

FPrintScan: PR00019
381-394 LEURICHRPT,Leucine-rich repeat signature

LTYLDLSRNGLTGL

Gene3D: G3DSA:3.80.10.10
454-634 G3DSA:3.80.10.10

LLDTVDLRNNHLNGSIPKSTFEIGRLKVLSLSSNFFSGTVTLDLIGRLNNLSVLELSYNNLTVDASSSNSTSFTFPQLSILKLASCRLQKFPDLMNQSRMFHLDLSDNQIRGAIPNWIWGIGGGGLTHLNLSFNQLEYVEQPYNASSNLFVLDLHSNRLKGDLPIPPSSAIYVDYSSNNLN

superfamily: SSF52058
621-983 SSF52058,LRR

SSAIYVDYSSNNLNNSIPLDIGNSIFLASFFSVANNSITGVIPESICNVSYLQVLDFSNNALSGTIPPCLLEYSTTLGVLNLGNNRLHGVIPDSFPIGCALKTLDLSRNTFEGKLPKSLVNCMFLEVLNVGNNSLVDRFPCMLRNSTSLRVLVLRSNQFNGNLTCNVTTNSWQNLQIIDIASNSFTGMLNAECFSKWRGMMVADDYVETGRNHIQYKFLQLSNLYYQDTVTLTIKGMELELVKILRVFTSIDFSSNRFQGKIPDTVGDLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSRNHLSGEIPTELSSLTFLAALNLSFNNFFGKIPRSNQLFTFSADSFEGNRGLCGLPLNVTC

Gene3D: G3DSA:3.80.10.10
635-797 G3DSA:3.80.10.10

NSIPLDIGNSIFLASFFSVANNSITGVIPESICNVSYLQVLDFSNNALSGTIPPCLLEYSTTLGVLNLGNNRLHGVIPDSFPIGCALKTLDLSRNTFEGKLPKSLVNCMFLEVLNVGNNSLVDRFPCMLRNSTSLRVLVLRSNQFNGNLTCNVTTNSWQNLQI

HMMPfam: PF00560
IPR001611
672-689 LRR_1
Leucine-rich repeat

LQVLDFSNNALSGTIPPC

HMMPfam: PF00560
IPR001611
721-742 LRR_1
Leucine-rich repeat

LKTLDLSRNTFEGKLPKSLVNC

HMMPfam: PF13855
870-926 LRR_8,Leucine rich repeat

SIDFSSNRFQGKIPDTVGDLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSRNHL

Gene3D: G3DSA:3.80.10.10
871-979 G3DSA:3.80.10.10

IDFSSNRFQGKIPDTVGDLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSRNHLSGEIPTELSSLTFLAALNLSFNNFFGKIPRSNQLFTFSADSFEGNRGLCGLPL

FPrintScan: PR00019
913-926 LEURICHRPT,Leucine-rich repeat signature

LQMLESLDLSRNHL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox