PRGDB00049057 (ve1)

From PRG Wiki
Jump to: navigation, search
ve1
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 46488258 (AY536526)
Gene Class Unknown
Domain Type LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Solanum aethiopicum

Comment?

Solanum aethiopicum verticillium wilt disease resistance protein (ve1) gene, partial cds.

DNA Sequence

TGACCCTGGGCTCTGTAATCTGCAGGGAACATTTCCAGAAAGAATCTTTCAGGTATCAGTTTTAGAGATTTTGGACTTGTCAAATAACAAGTTGCTTAGTGGTAGTATTCCGAATTTTCCTCGATATGGATCTTTGAGGAGGATATTGCTAAGCTACACCAACTTTTCTGGTTCATTACCAGACTCCATTTCGAACCTTCAGAATCTGTCCAGGTTAGAGCTCTCCTATTGCAATTTCAATGGACCAATACCCTCCACCATGGCAAACCTTACCAATCTTGTTTATTTAGATTTCTCCTCCAATAACTTCACTGGTTTTATACCATATTTCCAACGGTCCAAGAAACTCACCTACTTAGACCTTTCACGTAATGGTCTAACTGGTCTCTTCTCTAGAGCTCATTCTGAAGGACTCTCAGAGTTCGTCTACATGAATTTAGGGAACAATTCACTCAACGGGATCCTTCCTGCAGAAATATTTGAGCTCCCCTCCTTGCAGCAGCTCTTTCTTAACAGCAATCAATTTGTTGGCCAAGTCGACGAGTTACGCAATGCATCCTCCTCTCCGTTAGATATAATCGATTTGAGCAACAACCACCTGAATGGTTCAATTCCCAATTCCATGTTTGAAGTTAGGAGGCTTAAGGTCCTCTCACTTTCTTCCAACTTCTTTAGTGGGACAGTGCCCCTTGACCGCATTGGGAAGCTGAGCAACCTTTCAAGACTGGAGCTTTCTTACAATAACTTGACTGTTGATGCAAGTAGCAGCAATTCAACCTCTTTCACATTTCCCCAGCTGACTATATTGAAATTGGCTTCTTGTCGGCTGCAAAAGTTCCCTGATCTCAAGAATCAGTCAAGGATGATCCACTTAGACCTTTCAAACAACCAAATACGGGGGGCAATACCAAATTGGATCTGGGGAATTGGTGGTGGAGGTCTCACCCACCTGAATCTTTCATTCAATCAGCTGGAGTACGTGGAACAGCCTTACACTGCTTCCAGCAATCTTGTAGTCCTTGATTTGCATTCCAACCGTTTAAAAGGTGACTTACTAATACCACCTTGCACTGCCATCTATGTGAACTACTCTAGCAATAATTTAAACAATTCCATCCCAACAGATATTGGAAAGTCTCTTGGTTTTGCCTCCTTTTTCTCGGTAGCAAACAATGGCATTACTGGAATAATTCCTGAATCCATATGCAACTGCAGCTACCTTCAAGTTCTTGATTTCTCTAACAATGCCTTGAGTGGAACAATACCACCATGTCTACTGGAATATAGTACAAAACTTGGAGTGCTGAATCTTGGGAACAATAAACTCAATGGTGTTATACCAGATTCATTTTCAATTGGTTGTGCTCTACAAACATTAGACCTCAGTGCGAATAACTTACAAGGCAGGCTGCCAAAATCGATTGTGAATTGTAAGTTGTTGGAGGTCCTGAATGTTGGAAATAACAAACTTGTTGATCACTTCCCATGCATGTTGAGGAACTCGAACAGTCTGAGGGTCCTAGTCCTGCGCTCCAATCAATTCAATGGAAATCTTACATGTGATATAACCACAAATAGCTGGCAGAATCTCCAGATCATAGATATTGCTTCCAACAGTTTTACTGGCGTTTTGAATGCAGGATGCTTTTCTAATTGGAGAGGAATGATGGTTGCACATGATTACGTGGAGACAGGACGCAATCATATCCAATATAAGTTCTTCCAACTAAGTAACTTTTACTATCAGGACACAGTGACATTAACCATCAAAGGCATGGAGCTGGAGCTTGTGAAGATTCTCAGGGTCTTCACATCTATTGATTTCTCTTCAAATAGATTTCAAGGAGTGATACCAAATACGGTTGGGGATCTTAGCTCGCTTTATGTTCTGAACCTGTCACACAATGCCCTTGAGGGACCAATTCCAAAATCAATCGGTAAGCTACAAATGCTTGAATCACTAGACCTGTCAACAAACCACCTGTCCGGAGAGATCCCCTCAGAGCTTGCAAGTCTCACATTCTTAGCAGCTTTGATCTTATCATTCAACAATTTGTTTGGCAAAATCCCATCAACTAATCAATTTCTAACATTCTCAGCAGATTCCTTTGAAGGAAACAGAGGCCTCTGTGGGCTCCCTCTCAACAACAGTTGCGAAAGCAAGAGATCAGAGTTCATGCCGCTGCAAACTTCGCTACCAGAGTCAGATTTTGAATGGGAGTTCATTTTCGCGGCTGTTGGATACATAGTAGGGGCAGCAAAT


Protein sequences

Name Description Sequence
verticillium wilt disease resistance protein verticillium wilt disease resistance protein [Solanum aethiopicum].

DPGLCNLQGTFPERIFQVSVLEILDLSNNKLLSGSIPNFPRYGSLRRILLSYTNFSGSLPDSISNLQNLSRLELSYCNFNGPIPSTMANLTNLVYLDFSSNNFTGFIPYFQRSKKLTYLDLSRNGLTGLFSRAHSEGLSEFVYMNLGNNSLNGILPAEIFELPSLQQLFLNSNQFVGQVDELRNASSSPLDIIDLSNNHLNGSIPNSMFEVRRLKVLSLSSNFFSGTVPLDRIGKLSNLSRLELSYNNLTVDASSSNSTSFTFPQLTILKLASCRLQKFPDLKNQSRMIHLDLSNNQIRGAIPNWIWGIGGGGLTHLNLSFNQLEYVEQPYTASSNLVVLDLHSNRLKGDLLIPPCTAIYVNYSSNNLNNSIPTDIGKSLGFASFFSVANNGITGIIPESICNCSYLQVLDFSNNALSGTIPPCLLEYSTKLGVLNLGNNKLNGVIPDSFSIGCALQTLDLSANNLQGRLPKSIVNCKLLEVLNVGNNKLVDHFPCMLRNSNSLRVLVLRSNQFNGNLTCDITTNSWQNLQIIDIASNSFTGVLNAGCFSNWRGMMVAHDYVETGRNHIQYKFFQLSNFYYQDTVTLTIKGMELELVKILRVFTSIDFSSNRFQGVIPNTVGDLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSTNHLSGEIPSELASLTFLAALILSFNNLFGKIPSTNQFLTFSADSFEGNRGLCGLPLNNSCESKRSEFMPLQTSLPESDFEWEFIFAAVGYIVGAAN


Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.80.10.10
5-124 G3DSA:3.80.10.10

CNLQGTFPERIFQVSVLEILDLSNNKLLSGSIPNFPRYGSLRRILLSYTNFSGSLPDSISNLQNLSRLELSYCNFNGPIPSTMANLTNLVYLDFSSNNFTGFIPYFQRSKKLTYLDLSRN

HMMPanther: PTHR24420:SF473
7-753 PTHR24420:SF473,SUBFAMILY NOT NAMED

LQGTFPERIFQVSVLEILDLSNNKLLSGSIPNFPRYGSLRRILLSYTNFSGSLPDSISNLQNLSRLELSYCNFNGPIPSTMANLTNLVYLDFSSNNFTGFIPYFQRSKKLTYLDLSRNGLTGLFSRAHSEGLSEFVYMNLGNNSLNGILPAEIFELPSLQQLFLNSNQFVGQVDELRNASSSPLDIIDLSNNHLNGSIPNSMFEVRRLKVLSLSSNFFSGTVPLDRIGKLSNLSRLELSYNNLTVDASSSNSTSFTFPQLTILKLASCRLQKFPDLKNQSRMIHLDLSNNQIRGAIPNWIWGIGGGGLTHLNLSFNQLEYVEQPYTASSNLVVLDLHSNRLKGDLLIPPCTAIYVNYSSNNLNNSIPTDIGKSLGFASFFSVANNGITGIIPESICNCSYLQVLDFSNNALSGTIPPCLLEYSTKLGVLNLGNNKLNGVIPDSFSIGCALQTLDLSANNLQGRLPKSIVNCKLLEVLNVGNNKLVDHFPCMLRNSNSLRVLVLRSNQFNGNLTCDITTNSWQNLQIIDIASNSFTGVLNAGCFSNWRGMMVAHDYVETGRNHIQYKFFQLSNFYYQDTVTLTIKGMELELVKILRVFTSIDFSSNRFQGVIPNTVGDLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSTNHLSGEIPSELASLTFLAALILSFNNLFGKIPSTNQFLTFSADSFEGNRGLCGLPLNNSCESKRSEFMPLQTSLPESDFEWEFIFAAVGYIVGAA

HMMPanther: PTHR24420
7-753 PTHR24420,FAMILY NOT NAMED

LQGTFPERIFQVSVLEILDLSNNKLLSGSIPNFPRYGSLRRILLSYTNFSGSLPDSISNLQNLSRLELSYCNFNGPIPSTMANLTNLVYLDFSSNNFTGFIPYFQRSKKLTYLDLSRNGLTGLFSRAHSEGLSEFVYMNLGNNSLNGILPAEIFELPSLQQLFLNSNQFVGQVDELRNASSSPLDIIDLSNNHLNGSIPNSMFEVRRLKVLSLSSNFFSGTVPLDRIGKLSNLSRLELSYNNLTVDASSSNSTSFTFPQLTILKLASCRLQKFPDLKNQSRMIHLDLSNNQIRGAIPNWIWGIGGGGLTHLNLSFNQLEYVEQPYTASSNLVVLDLHSNRLKGDLLIPPCTAIYVNYSSNNLNNSIPTDIGKSLGFASFFSVANNGITGIIPESICNCSYLQVLDFSNNALSGTIPPCLLEYSTKLGVLNLGNNKLNGVIPDSFSIGCALQTLDLSANNLQGRLPKSIVNCKLLEVLNVGNNKLVDHFPCMLRNSNSLRVLVLRSNQFNGNLTCDITTNSWQNLQIIDIASNSFTGVLNAGCFSNWRGMMVAHDYVETGRNHIQYKFFQLSNFYYQDTVTLTIKGMELELVKILRVFTSIDFSSNRFQGVIPNTVGDLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSTNHLSGEIPSELASLTFLAALILSFNNLFGKIPSTNQFLTFSADSFEGNRGLCGLPLNNSCESKRSEFMPLQTSLPESDFEWEFIFAAVGYIVGAA

HMMPfam: PF00560
IPR001611
21-39 LRR_1
Leucine-rich repeat

LEILDLSNNKLLSGSIPNF

superfamily: SSF52047
24-348 SSF52047,LRR

LDLSNNKLLSGSIPNFPRYGSLRRILLSYTNFSGSLPDSISNLQNLSRLELSYCNFNGPIPSTMANLTNLVYLDFSSNNFTGFIPYFQRSKKLTYLDLSRNGLTGLFSRAHSEGLSEFVYMNLGNNSLNGILPAEIFELPSLQQLFLNSNQFVGQVDELRNASSSPLDIIDLSNNHLNGSIPNSMFEVRRLKVLSLSSNFFSGTVPLDRIGKLSNLSRLELSYNNLTVDASSSNSTSFTFPQLTILKLASCRLQKFPDLKNQSRMIHLDLSNNQIRGAIPNWIWGIGGGGLTHLNLSFNQLEYVEQPYTASSNLVVLDLHSNRLK

HMMPfam: PF00560
IPR001611
92-111 LRR_1
Leucine-rich repeat

NLVYLDFSSNNFTGFIPYFQ

HMMPfam: PF13855
115-174 LRR_8,Leucine rich repeat

KLTYLDLSRNGLTGLFSRAHSEGLSEFVYMNLGNNSLNGILPAEIFELPSLQQLFLNSNQ

FPrintScan: PR00019
116-129 LEURICHRPT,Leucine-rich repeat signature

LTYLDLSRNGLTGL

Gene3D: G3DSA:3.80.10.10
125-365 G3DSA:3.80.10.10

GLTGLFSRAHSEGLSEFVYMNLGNNSLNGILPAEIFELPSLQQLFLNSNQFVGQVDELRNASSSPLDIIDLSNNHLNGSIPNSMFEVRRLKVLSLSSNFFSGTVPLDRIGKLSNLSRLELSYNNLTVDASSSNSTSFTFPQLTILKLASCRLQKFPDLKNQSRMIHLDLSNNQIRGAIPNWIWGIGGGGLTHLNLSFNQLEYVEQPYTASSNLVVLDLHSNRLKGDLLIPPCTAIYVNYSS

HMMPfam: PF00560
IPR001611
190-210 LRR_1
Leucine-rich repeat

LDIIDLSNNHLNGSIPNSMFE

HMMPfam: PF00560
IPR001611
289-306 LRR_1
Leucine-rich repeat

IHLDLSNNQIRGAIPNWI

superfamily: SSF52058
356-718 SSF52058,LRR

CTAIYVNYSSNNLNNSIPTDIGKSLGFASFFSVANNGITGIIPESICNCSYLQVLDFSNNALSGTIPPCLLEYSTKLGVLNLGNNKLNGVIPDSFSIGCALQTLDLSANNLQGRLPKSIVNCKLLEVLNVGNNKLVDHFPCMLRNSNSLRVLVLRSNQFNGNLTCDITTNSWQNLQIIDIASNSFTGVLNAGCFSNWRGMMVAHDYVETGRNHIQYKFFQLSNFYYQDTVTLTIKGMELELVKILRVFTSIDFSSNRFQGVIPNTVGDLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSTNHLSGEIPSELASLTFLAALILSFNNLFGKIPSTNQFLTFSADSFEGNRGLCGLPLNNSC

Gene3D: G3DSA:3.80.10.10
366-552 G3DSA:3.80.10.10

NNLNNSIPTDIGKSLGFASFFSVANNGITGIIPESICNCSYLQVLDFSNNALSGTIPPCLLEYSTKLGVLNLGNNKLNGVIPDSFSIGCALQTLDLSANNLQGRLPKSIVNCKLLEVLNVGNNKLVDHFPCMLRNSNSLRVLVLRSNQFNGNLTCDITTNSWQNLQIIDIASNSFTGVLNAGCFSNW

HMMPfam: PF13855
388-442 LRR_8,Leucine rich repeat

VANNGITGIIPESICNCSYLQVLDFSNNALSGTIPPCLLEYSTKLGVLNLGNNKL

HMMPfam: PF13855
456-513 LRR_8,Leucine rich repeat

LQTLDLSANNLQGRLPKSIVNCKLLEVLNVGNNKLVDHFPCMLRNSNSLRVLVLRSNQ

Gene3D: G3DSA:3.80.10.10
603-715 G3DSA:3.80.10.10

FTSIDFSSNRFQGVIPNTVGDLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSTNHLSGEIPSELASLTFLAALILSFNNLFGKIPSTNQFLTFSADSFEGNRGLCGLPLN

HMMPfam: PF13855
605-661 LRR_8,Leucine rich repeat

SIDFSSNRFQGVIPNTVGDLSSLYVLNLSHNALEGPIPKSIGKLQMLESLDLSTNHL

FPrintScan: PR00019
624-637 LEURICHRPT,Leucine-rich repeat signature

LSSLYVLNLSHNAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox