PRGDB00049058 (At1g63880/T12P18_10)

From PRG Wiki
Jump to: navigation, search
At1g63880/T12P18_10
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 39104606 (AK119065)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana At1g63880 mRNA for putative disease resistance protein, complete cds, clone: RAFL21-41-E18.

DNA Sequence

ATGGCTTCTCCTTCTTCTTTTTCGTCTCAGAACTACAAGTTCAATGTCTTCGCGAGCTTCCACGGGCCTGACGTCCGTAAAACACTTCTCAGTCACATACGACTACAGTTTAACCGCAACGGGATCACTATGTTTGATGATCAAAAGATTGTGAGAAGCGCAACGATCGGGCCTTCACTAGTAGAAGCTATAAAAGAATCAAGGATCTCGATCGTGATTCTCTCCAAGAAATATGCTTCATCAAGCTGGTGTTTGGATGAATTGGTGGAGATCTTGGAGTGCAAGAAAGCTATGGGACAGATAGTGATGACCATCTTCTACGGAGTAGATCCATCCGATGTGCGGAAACAGATCGGGAAATTCGGGATCGCTTTCAATGAAACTTGTGCACGTAAGACCGAGGAGGAAAGGCAAAAATGGAGCAAAGCTTTGAACCAAGTCAGCAATATTGCTGGAGAAGACTTCTTAAGATGGGACAATGAAGCTATAATGATCGAAAAGATTGCCAGAGATGTTTTAGATAAACTGAATGCTACACCATCTAGGGATTTTGATGGTATGGTGGGAATTGAAGCTCATTTGAGAGAAATAAAATCTTTGCTAGATTTAGATAATGTTGAAGTTAAGATAGTTGCAATCGCTGGTCCTGCTGGGATTGGTAAGACTACTATTGCCAGAGCTTTATATGGTTTACTCTCTAAAAGGTTTCAACTTAGTTGTTTTGTGGACAACCTTAGGGGAAGCTATCATAGTGGTTTTGATGAGTATGGTTTTAAGCTGCATTTACAAGAACAGTTTCTTTCAAAGGTTTTGAACCAAAGTGGAATGAGAATATGCCATTTAGGTGCAATAAAAGAAAATCTAAGCGACCAGAGAGTGCTCATCATTCTTGATGATGTGAACAAGTTAAAGCAGTTGGAGGCTTTGGCTAATGGAACTACATGGTTCGGTCCAGGAAGTAGGATTGTAGTTACCACAGAAAACAAAGAGCTTTTGCAGCAACATGGTATTAACAATACCTACCATGTGGGGTTTCCATCTGATGAAGATGCTCTCAAGATCTTGTGTAGTTATGCTTTTAAACAGACCTCTCCACGTCATGGTTTTGAAGAGCTTTCAGAAAGTGTAACAAAGCTTTGTGGTAAGCTTCCGTTGGGTCTTTGTGTCGTGGGTTCATCTTTACGGGGGAAGAAGGAAGACGAATGGGAAGATGTTGTGACCAGGCTGGAAACTATTCTTGATCAAGATATCGAAGACGTACTAAGAGTTGGCTATGAAAGTTTAGATGAGAATGCGCAAACACTATTTCTCCACATTGCAATCTTCTTCAACAAGGAAGATGGTGATCTTGTGAAAACCATGTTCGCTGAGAGTGACTTGGATGTCAAATACGGGCTGAAAATCCTTGAAAACAGATCTCTCATAAAGATGAAGATTTTTAGCAATGGGGATACAAAAATAGTGATGCACAGATTACTACAACAAATGGGTAAAAGAGCTATTCAAAAACAAGAGCCTTGGGAACGCCAAATCTTAATAGATGCCCGGGAGATTTGTCATGTTCTTGAGCACGCCAAAGGTACCGGCTGGAATGTTCATGGTATGTCATTTGATATATCAAGAATCAGTGAAGTGTCTATAAGGAAGAAAGCTTTTAAAAGAATGCCTAATCTTCAGTTCCTCAAAGTTTACAAAAGTAAAGATGATGGGAATAATAGAATGCATGTACCTGAGGAGATGGACTTTCCTTGTCTCCTAAGGTTGTTAGATTGGAAGGCGTACCCAAGCAAGAGTCTTCCTCCTACATTTAATCCAGAACATCTTGTCGAACTCAATATGCATTCTAGCCAGCTCGAGTACCTCTGGCAAGGAACTCAGCCGCTCAAGAATCTCAAGAAGATGGATTTGTCACAGTCCAAGAATTTGAAGCAACTCCCGGATCTTTCAAATGCTACAAATCTGGAGTATTTGTATCTGATGGGTTGCGAGAGTTTGATAGAGATTCCATCATCTATTTCGCATCTTCATAAACTAGAGATGTTGGCGACGGTGGGCTGTATAAATCTAGAAGTCATACCAGCTCACATGAACTTGGAATCTCTTCAAACAGTCTACTTGGGAGGATGCTCAAGACTAAGAAATATTCCAGTGATGTCAACGAACATCAGATATTTATTTATAACGAACACAGCAGTTGAAGGCGTGCCTCTTTGCCCTGGTCTTAAGACTCTCGATGTAAGCGGCAGCAGAAATTTCAAGGGATTATTAACACATCTCCCCACGAGTTTAACAACACTAAACCTATGCTATACTGATATTGAAAGAATTCCAGATTGTTTCAAATCTCTTCATCAACTAAAAGGGGTTAATCTACGTGGCTGCAGAAGACTCGCATCTTTGCCAGAGCTCCCTCGTTCGCTACTAACCCTAGTGGCAGACGACTGTGAATCACTGGAGACGGTGTTTTGCCCTTTGAACACTTTAAAAGCGAGCTTCAGTTTCGCCAACTGCTTCAAATTGGACCGAGAAGCACGAAGAGCAATTATCCAACAATCGTTTTTCATGGGAAAGGCTGTGTTACCAGGAAGAGAAGTGCCTGCAGTGTTCGATCACAGAGCCAAAGGATATTCATTGACCATTCGTCCAGACGGTAACCCTTACACCAGCTTTGTATTTTGCGTTGTGGTTTCCCGTAACCAAAAAAGTGATAAAACCATTCCTCCCTCACTATTGTGGCGTCGCATCATAGCTCAAGATGAGGGCTATCCCGTTGAGGTCTGGAACCGCATAGGAGATGTCTTCAAATATCGAACGGAACATCTATTAATATTTCACTTCGACTTTCTAGAATTCGACAACAGGGATATAGTGTTCGAATTCAGCAGCGAATCCCACGACTTCGACATTATTGAATGTGGTGCTAAAGTCTTGGCCGAAAAGAGCATCAAAGAAAGCTATGAATCTGGATCCGACCAAGCCTTTGAAGACGACGTTGTGTTTGAACCCAGCAAAGCCTTCGGAGACGAAAAATACGGAGATTGTTGTATTTTGTAA


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Arabidopsis thaliana].

MASPSSFSSQNYKFNVFASFHGPDVRKTLLSHIRLQFNRNGITMFDDQKIVRSATIGPSLVEAIKESRISIVILSKKYASSSWCLDELVEILECKKAMGQIVMTIFYGVDPSDVRKQIGKFGIAFNETCARKTEEERQKWSKALNQVSNIAGEDFLRWDNEAIMIEKIARDVLDKLNATPSRDFDGMVGIEAHLREIKSLLDLDNVEVKIVAIAGPAGIGKTTIARALYGLLSKRFQLSCFVDNLRGSYHSGFDEYGFKLHLQEQFLSKVLNQSGMRICHLGAIKENLSDQRVLIILDDVNKLKQLEALANGTTWFGPGSRIVVTTENKELLQQHGINNTYHVGFPSDEDALKILCSYAFKQTSPRHGFEELSESVTKLCGKLPLGLCVVGSSLRGKKEDEWEDVVTRLETILDQDIEDVLRVGYESLDENAQTLFLHIAIFFNKEDGDLVKTMFAESDLDVKYGLKILENRSLIKMKIFSNGDTKIVMHRLLQQMGKRAIQKQEPWERQILIDAREICHVLEHAKGTGWNVHGMSFDISRISEVSIRKKAFKRMPNLQFLKVYKSKDDGNNRMHVPEEMDFPCLLRLLDWKAYPSKSLPPTFNPEHLVELNMHSSQLEYLWQGTQPLKNLKKMDLSQSKNLKQLPDLSNATNLEYLYLMGCESLIEIPSSISHLHKLEMLATVGCINLEVIPAHMNLESLQTVYLGGCSRLRNIPVMSTNIRYLFITNTAVEGVPLCPGLKTLDVSGSRNFKGLLTHLPTSLTTLNLCYTDIERIPDCFKSLHQLKGVNLRGCRRLASLPELPRSLLTLVADDCESLETVFCPLNTLKASFSFANCFKLDREARRAIIQQSFFMGKAVLPGREVPAVFDHRAKGYSLTIRPDGNPYTSFVFCVVVSRNQKSDKTIPPSLLWRRIIAQDEGYPVEVWNRIGDVFKYRTEHLLIFHFDFLEFDNRDIVFEFSSESHDFDIIECGAKVLAEKSIKESYESGSDQAFEDDVVFEPSKAFGDEKYGDCCIL

Domains

Domain Start-End Description Sequence

Gene3D: G3DSA:3.40.50.10140
9-148 G3DSA:3.40.50.10140

SQNYKFNVFASFHGPDVRKTLLSHIRLQFNRNGITMFDDQKIVRSATIGPSLVEAIKESRISIVILSKKYASSSWCLDELVEILECKKAMGQIVMTIFYGVDPSDVRKQIGKFGIAFNETCARKTEEERQKWSKALNQVS

ProfileScan: PS50104
IPR000157
12-150 TIR
Toll/interleukin-1 receptor homology (TIR) domain

YKFNVFASFHGPDVRKTLLSHIRLQFNRNGITMFDDQKIVRSATIGPSLVEAIKESRISIVILSKKYASSSWCLDELVEILECKKAMGQIVMTIFYGVDPSDVRKQIGKFGIAFNETCARKTEEERQKWSKALNQVSNI

HMMSmart: SM00255
IPR000157
13-150 TIR
Toll/interleukin-1 receptor homology (TIR) domain

KFNVFASFHGPDVRKTLLSHIRLQFNRNGITMFDDQKIVRSATIGPSLVEAIKESRISIVILSKKYASSSWCLDELVEILECKKAMGQIVMTIFYGVDPSDVRKQIGKFGIAFNETCARKTEEERQKWSKALNQVSNI

HMMPfam: PF01582
IPR000157
16-146 TIR
Toll/interleukin-1 receptor homology (TIR) domain

VFASFHGPDVRKTLLSHIRLQFNRNGITMFDDQKIVRSATIGPSLVEAIKESRISIVILSKKYASSSWCLDELVEILECKKAMGQIVMTIFYGVDPSDVRKQIGKFGIAFNETCARKTEEERQKWSKALNQ

HMMPanther: PTHR11017
36-1001 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

QFNRNGITMFDDQKIVRSATIGPSLVEAIKESRISIVILSKKYASSSWCLDELVEILECKKAMGQIVMTIFYGVDPSDVRKQIGKFGIAFNETCARKTEEERQKWSKALNQVSNIAGEDFLRWDNEAIMIEKIARDVLDKLNATPSRDFDGMVGIEAHLREIKSLLDLDNVEVKIVAIAGPAGIGKTTIARALYGLLSKRFQLSCFVDNLRGSYHSGFDEYGFKLHLQEQFLSKVLNQSGMRICHLGAIKENLSDQRVLIILDDVNKLKQLEALANGTTWFGPGSRIVVTTENKELLQQHGINNTYHVGFPSDEDALKILCSYAFKQTSPRHGFEELSESVTKLCGKLPLGLCVVGSSLRGKKEDEWEDVVTRLETILDQDIEDVLRVGYESLDENAQTLFLHIAIFFNKEDGDLVKTMFAESDLDVKYGLKILENRSLIKMKIFSNGDTKIVMHRLLQQMGKRAIQKQEPWERQILIDAREICHVLEHAKGTGWNVHGMSFDISRISEVSIRKKAFKRMPNLQFLKVYKSKDDGNNRMHVPEEMDFPCLLRLLDWKAYPSKSLPPTFNPEHLVELNMHSSQLEYLWQGTQPLKNLKKMDLSQSKNLKQLPDLSNATNLEYLYLMGCESLIEIPSSISHLHKLEMLATVGCINLEVIPAHMNLESLQTVYLGGCSRLRNIPVMSTNIRYLFITNTAVEGVPLCPGLKTLDVSGSRNFKGLLTHLPTSLTTLNLCYTDIERIPDCFKSLHQLKGVNLRGCRRLASLPELPRSLLTLVADDCESLETVFCPLNTLKASFSFANCFKLDREARRAIIQQSFFMGKAVLPGREVPAVFDHRAKGYSLTIRPDGNPYTSFVFCVVVSRNQKSDKTIPPSLLWRRIIAQDEGYPVEVWNRIGDVFKYRTEHLLIFHFDFLEFDNRDIVFEFSSESHDFDIIECGAKVLAEKSIKESYESGSDQAFEDDVVFE

HMMPanther: PTHR11017:SF20
36-1001 PTHR11017:SF20,SUBFAMILY NOT NAMED

QFNRNGITMFDDQKIVRSATIGPSLVEAIKESRISIVILSKKYASSSWCLDELVEILECKKAMGQIVMTIFYGVDPSDVRKQIGKFGIAFNETCARKTEEERQKWSKALNQVSNIAGEDFLRWDNEAIMIEKIARDVLDKLNATPSRDFDGMVGIEAHLREIKSLLDLDNVEVKIVAIAGPAGIGKTTIARALYGLLSKRFQLSCFVDNLRGSYHSGFDEYGFKLHLQEQFLSKVLNQSGMRICHLGAIKENLSDQRVLIILDDVNKLKQLEALANGTTWFGPGSRIVVTTENKELLQQHGINNTYHVGFPSDEDALKILCSYAFKQTSPRHGFEELSESVTKLCGKLPLGLCVVGSSLRGKKEDEWEDVVTRLETILDQDIEDVLRVGYESLDENAQTLFLHIAIFFNKEDGDLVKTMFAESDLDVKYGLKILENRSLIKMKIFSNGDTKIVMHRLLQQMGKRAIQKQEPWERQILIDAREICHVLEHAKGTGWNVHGMSFDISRISEVSIRKKAFKRMPNLQFLKVYKSKDDGNNRMHVPEEMDFPCLLRLLDWKAYPSKSLPPTFNPEHLVELNMHSSQLEYLWQGTQPLKNLKKMDLSQSKNLKQLPDLSNATNLEYLYLMGCESLIEIPSSISHLHKLEMLATVGCINLEVIPAHMNLESLQTVYLGGCSRLRNIPVMSTNIRYLFITNTAVEGVPLCPGLKTLDVSGSRNFKGLLTHLPTSLTTLNLCYTDIERIPDCFKSLHQLKGVNLRGCRRLASLPELPRSLLTLVADDCESLETVFCPLNTLKASFSFANCFKLDREARRAIIQQSFFMGKAVLPGREVPAVFDHRAKGYSLTIRPDGNPYTSFVFCVVVSRNQKSDKTIPPSLLWRRIIAQDEGYPVEVWNRIGDVFKYRTEHLLIFHFDFLEFDNRDIVFEFSSESHDFDIIECGAKVLAEKSIKESYESGSDQAFEDDVVFE

superfamily: SSF52540
67-437 SSF52540

SRISIVILSKKYASSSWCLDELVEILECKKAMGQIVMTIFYGVDPSDVRKQIGKFGIAFNETCARKTEEERQKWSKALNQVSNIAGEDFLRWDNEAIMIEKIARDVLDKLNATPSRDFDGMVGIEAHLREIKSLLDLDNVEVKIVAIAGPAGIGKTTIARALYGLLSKRFQLSCFVDNLRGSYHSGFDEYGFKLHLQEQFLSKVLNQSGMRICHLGAIKENLSDQRVLIILDDVNKLKQLEALANGTTWFGPGSRIVVTTENKELLQQHGINNTYHVGFPSDEDALKILCSYAFKQTSPRHGFEELSESVTKLCGKLPLGLCVVGSSLRGKKEDEWEDVVTRLETILDQDIEDVLRVGYESLDENAQTLFL

Gene3D: G3DSA:3.40.50.300
183-215 G3DSA:3.40.50.300

DFDGMVGIEAHLREIKSLLDLDNVEVKIVAIAG

HMMPfam: PF00931
IPR002182
191-447 NB-ARC,NBS
NB-ARC

EAHLREIKSLLDLDNVEVKIVAIAGPAGIGKTTIARALYGLLSKRFQLSCFVDNLRGSYHSGFDEYGFKLHLQEQFLSKVLNQSGMRICHLGAIKENLSDQRVLIILDDVNKLKQLEALANGTTWFGPGSRIVVTTENKELLQQHGINNTYHVGFPSDEDALKILCSYAFKQTSPRHGFEELSESVTKLCGKLPLGLCVVGSSLRGKKEDEWEDVVTRLETILDQDIEDVLRVGYESLDENAQTLFLHIAIFFNKED

HMMSmart: SM00382
IPR003593
207-424 AAA,NBS
AAA+ ATPase domain

EVKIVAIAGPAGIGKTTIARALYGLLSKRFQLSCFVDNLRGSYHSGFDEYGFKLHLQEQFLSKVLNQSGMRICHLGAIKENLSDQRVLIILDDVNKLKQLEALANGTTWFGPGSRIVVTTENKELLQQHGINNTYHVGFPSDEDALKILCSYAFKQTSPRHGFEELSESVTKLCGKLPLGLCVVGSSLRGKKEDEWEDVVTRLETILDQDIEDVLRVG

FPrintScan: PR00364
IPR000767
210-225 DISEASERSIST
Disease resistance protein

IVAIAGPAGIGKTTIA

Gene3D: G3DSA:3.40.50.300
216-230 G3DSA:3.40.50.300

PAGIGKTTIARALYG

Gene3D: G3DSA:3.40.50.300
231-335 G3DSA:3.40.50.300

LLSKRFQLSCFVDNLRGSYHSGFDEYGFKLHLQEQFLSKVLNQSGMRICHLGAIKENLSDQRVLIILDDVNKLKQLEALANGTTWFGPGSRIVVTTENKELLQQH

FPrintScan: PR00364
IPR000767
287-301 DISEASERSIST
Disease resistance protein

NLSDQRVLIILDDVN

FPrintScan: PR00364
IPR000767
380-394 DISEASERSIST
Disease resistance protein

CGKLPLGLCVVGSSL

Gene3D: G3DSA:3.40.50.300
410-444 G3DSA:3.40.50.300

ETILDQDIEDVLRVGYESLDENAQTLFLHIAIFFN

superfamily: SSF52058
507-855 SSF52058,LRR

WERQILIDAREICHVLEHAKGTGWNVHGMSFDISRISEVSIRKKAFKRMPNLQFLKVYKSKDDGNNRMHVPEEMDFPCLLRLLDWKAYPSKSLPPTFNPEHLVELNMHSSQLEYLWQGTQPLKNLKKMDLSQSKNLKQLPDLSNATNLEYLYLMGCESLIEIPSSISHLHKLEMLATVGCINLEVIPAHMNLESLQTVYLGGCSRLRNIPVMSTNIRYLFITNTAVEGVPLCPGLKTLDVSGSRNFKGLLTHLPTSLTTLNLCYTDIERIPDCFKSLHQLKGVNLRGCRRLASLPELPRSLLTLVADDCESLETVFCPLNTLKASFSFANCFKLDREARRAIIQQSFFM

Gene3D: G3DSA:3.80.10.10
536-816 G3DSA:3.80.10.10

SFDISRISEVSIRKKAFKRMPNLQFLKVYKSKDDGNNRMHVPEEMDFPCLLRLLDWKAYPSKSLPPTFNPEHLVELNMHSSQLEYLWQGTQPLKNLKKMDLSQSKNLKQLPDLSNATNLEYLYLMGCESLIEIPSSISHLHKLEMLATVGCINLEVIPAHMNLESLQTVYLGGCSRLRNIPVMSTNIRYLFITNTAVEGVPLCPGLKTLDVSGSRNFKGLLTHLPTSLTTLNLCYTDIERIPDCFKSLHQLKGVNLRGCRRLASLPELPRSLLTLVADDCE

HMMPfam: PF07725
IPR011713
607-626 LRR_3
Leucine-rich repeat 3

HLVELNMHSSQLEYLWQGTQ

FPrintScan: PR00364
IPR000767
626-642 DISEASERSIST
Disease resistance protein

QPLKNLKKMDLSQSKNL

HMMPfam: PF00560
IPR001611
653-675 LRR_1
Leucine-rich repeat

NLEYLYLMGCESLIEIPSSISHL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox