PRGDB00049059 (At5g40910/MHK7_14)

From PRG Wiki
Jump to: navigation, search
At5g40910/MHK7_14
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 39104559 (AK117122)
Gene Class NL
Domain Type LRR, LRR, NBS, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana At5g40910 mRNA for putative disease resistance protein, complete cds, clone: RAFL16-65-P20.

DNA Sequence

ATGGATCAAAGCTTTGGAATATATAGCAACCGTAGCTGGAGAACACTCTCTAAGCTGTTTTTTTTTTTTTTCTCTTGGCTCAATGAGGCTAATGAAGCAGAGTTGATCCAAAAGATTGCTACAGATGTTTCAAACAAACTTAATCTTACACCGTCGAGGGATTTTGAGGGGATGGTGGGACTTGAAGCTCATTTGACAAAACTGGACTCTTTTTTATGCCTTGAGAGTGATGATGTAAAGATGATTGGCATTTGGGGTCCTGCTGGAATTGGTAAGACTACCATTGCTAGAGCTTTATTTAACCAACTCTCTACCGGTTTTCGGCTTAGTTGTTTTATGGGGACCATTGATGTTAATGACTATGATTCGAAGTTGTGTTTGCAAAACAAGCTTCTGTCCAAAATTTTGAACCAAAAGGATATGAAGATACATCATTTAGGCGCAATTGAAGAATGGCTACATAACCAAAGAGTTCTTATAGTTCTTGATGATGTGGATGATCTAGAGCAACTAGAGGTATTGGCTAAAGAAAGTTCTTGGTTCGGTCATGGAAGTCGGATCATTGTTTCCTTAAATGATAGAAAGATTTTGAAGGCACATGGGATCAACGATATCTACGATGTGGATTTTCCATCAGAAGAAGAAGCTCTTGAGATCTTATGTCTATCTGCTTTCAAACAAAATTCTCCACAAGATGGTTTTGAAGAGGTTGCAAAAAGAGTAGTAGAGCTTTGCGGTAAGCTTCCATTGGGCCTTCGTGTTGTGGGTTCTTCTTTTTATGGGGAGAGCGAGGATGAGTGGAGAATTCAATTATATGGAATTGAAACTAATCTTGATAGGAAAATTGAGAATGTCTTGAGAGTGGGATATGACAAATTGTCGGAGCGACATCAATCTTTGTTTCTTCATATTGCATGCTTTTTCAACCATAAAAGTGTTGATTATGTGACAACCATGCTCGCTGACAGTACTTTGGATGTCGAAAATGGGTTAAAGACCTTAGCCGCTAAATCTCTTGTGTCTACTAATGGATGGATAACGATGCACTGTCTACTACAACAATTGGGTAGACAAGTTGTTGTTCAACAGGGTGACCCGGGGAAACGTCAGTTTTTAGTAGAGGCCAAAGAGATTCGCGATGTCTTGGCAAATGAAAAAGGTACTGAATCCGTCATAGGTATATCGTTTGACATTTCGAAGATCGAGACGTTATCTATAAGCAAGCGAGCCTTTAATAGAATGCGTAATCTCAAATTCTTAAATTTCTATAATGGAAGTGTTAGCTTGTTAGAGGACATGGAATATCTACCTCGTCTAAGGTTACTTTATTGGGGTTCATACCCGAGAAAAAGTCTTCCTCTGACATTTAAGCCAGAATGTCTCGTCGAACTCTATATGGGATTCAGCAAGTTGGAGAAGCTATGGGGAGGAATCCAGCCCCTCACAAATCTAAAGAAAATAAATTTGGGATATTCCTCTAATTTGAAAGAAATCCCAAATCTTTCGAAAGCCACTAACCTCAAGACGTTGACGCTTACCGGTTGTGAGAGTTTGGTGGAGATTCCATCCTCTATTTGGAATCTACAGAAACTGGAAATGCTGTATGCGTCAGGATGCATTAAGCTACAAGTTATTCCCACCAACATCAACTTAGCATCTCTTGAGGAAGTCAACATGAGTAATTGCTCACGTCTGAGAAGTTTTCCAGATATATCTAGTAACATTAAGCGTCTCTATGTAGCAGGCACAATGATTAAAGAATTTCCTGCATCCATTGTTGGACACTGGTGTCGTCTTGATTTTCTTCAGATAGGCAGCAGAAGCCTCAAGAGATTAACACATGTCCCAGAGAGTGTAACACATCTAGACCTACGCAACAGTGATATAAAGATGATCCCAGATTGCGTCATAGGTCTTCCGCATCTAGTATCTCTTCTCGTCGAAAACTGCACAAAACTGGTGTCAATTCAGGGTCATTCCCCTTCGCTGGTGACCCTATTTGCAGACCACTGTATATCACTCAAGAGCGTATGCTGCTCTTTCCACGGACCAATCTCGAAATTGATGTTCTACAACTGTCTGAAACTGGATAAGGAATCAAAAAGAGGAATCATACAACAATCGGGTAACAAGTCTATATGCTTGCCAGGTAAAGAAATCCCTGCAGAGTTCACTCACCAAACTATAGGGAACTTGATAACCATCTCCCTGGCTCCAGGTTGTGAGGAGGCTTATTCTACGTTCTCAAGATTTAAGGCTTGCCTCCTGCTTTCGCCAATCAAGAATTTCGCATTTAATAAGATAAATTGTTTTCTAAGAAGCAAAGGTGTCGAAATTAGTCGCACTACAGAGTCTATATATCCTTTTGTGTCTGGTGGATCTCTATCAGAACATCTGTTTATCTTTTGTGGCGACTTATTTCCTGAAGAAAACAGAAGCCTTATGGACGTGACTCCGAACGAGATTCTGTTTGATTTCAGCTCCAGTGATGTCGAGATTGTGGAATGTGGTGTAAAGATCTTTTTAAGTAGTGGCATTGAAGTGGGCTACTGTGAAACTGGAGGCAACAGAAACCACCACATAGATGGAGAAGCAGAAGCGTTTAAGGTAACTCAAGTTGAAAACAGTAAACATACAGGCCACTGGAGTTGGCTTAGGAAGCTTCGTCTGGGGAAGAAGAAGATGAAGAATAATAAGACAGAGCTTAGTTCGAGACCAGTCTCAGGATTTAGTGATCTTACTCGGGGAATCTTTATAAGGTATCAGGAGCCTGAAGCTGTTGAGCTCACTAAAGATGAAAGAATCACAGATCTTTCGAGTTTACTATGTATTGGTTCCCTTGTGGTCTGTTTTTTTCTTTCTGTTTTTTTCGGGCAACCCCTTGTGGTCTCTGTTTTGTTGCTTTTTTCTTGCTTCTTTCTTCAGATGCAATGA


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Arabidopsis thaliana].

MDQSFGIYSNRSWRTLSKLFFFFFSWLNEANEAELIQKIATDVSNKLNLTPSRDFEGMVGLEAHLTKLDSFLCLESDDVKMIGIWGPAGIGKTTIARALFNQLSTGFRLSCFMGTIDVNDYDSKLCLQNKLLSKILNQKDMKIHHLGAIEEWLHNQRVLIVLDDVDDLEQLEVLAKESSWFGHGSRIIVSLNDRKILKAHGINDIYDVDFPSEEEALEILCLSAFKQNSPQDGFEEVAKRVVELCGKLPLGLRVVGSSFYGESEDEWRIQLYGIETNLDRKIENVLRVGYDKLSERHQSLFLHIACFFNHKSVDYVTTMLADSTLDVENGLKTLAAKSLVSTNGWITMHCLLQQLGRQVVVQQGDPGKRQFLVEAKEIRDVLANEKGTESVIGISFDISKIETLSISKRAFNRMRNLKFLNFYNGSVSLLEDMEYLPRLRLLYWGSYPRKSLPLTFKPECLVELYMGFSKLEKLWGGIQPLTNLKKINLGYSSNLKEIPNLSKATNLKTLTLTGCESLVEIPSSIWNLQKLEMLYASGCIKLQVIPTNINLASLEEVNMSNCSRLRSFPDISSNIKRLYVAGTMIKEFPASIVGHWCRLDFLQIGSRSLKRLTHVPESVTHLDLRNSDIKMIPDCVIGLPHLVSLLVENCTKLVSIQGHSPSLVTLFADHCISLKSVCCSFHGPISKLMFYNCLKLDKESKRGIIQQSGNKSICLPGKEIPAEFTHQTIGNLITISLAPGCEEAYSTFSRFKACLLLSPIKNFAFNKINCFLRSKGVEISRTTESIYPFVSGGSLSEHLFIFCGDLFPEENRSLMDVTPNEILFDFSSSDVEIVECGVKIFLSSGIEVGYCETGGNRNHHIDGEAEAFKVTQVENSKHTGHWSWLRKLRLGKKKMKNNKTELSSRPVSGFSDLTRGIFIRYQEPEAVELTKDERITDLSSLLCIGSLVVCFFLSVFFGQPLVVSVLLLFSCFFLQMQ

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF20
1-841 PTHR11017:SF20,SUBFAMILY NOT NAMED

MDQSFGIYSNRSWRTLSKLFFFFFSWLNEANEAELIQKIATDVSNKLNLTPSRDFEGMVGLEAHLTKLDSFLCLESDDVKMIGIWGPAGIGKTTIARALFNQLSTGFRLSCFMGTIDVNDYDSKLCLQNKLLSKILNQKDMKIHHLGAIEEWLHNQRVLIVLDDVDDLEQLEVLAKESSWFGHGSRIIVSLNDRKILKAHGINDIYDVDFPSEEEALEILCLSAFKQNSPQDGFEEVAKRVVELCGKLPLGLRVVGSSFYGESEDEWRIQLYGIETNLDRKIENVLRVGYDKLSERHQSLFLHIACFFNHKSVDYVTTMLADSTLDVENGLKTLAAKSLVSTNGWITMHCLLQQLGRQVVVQQGDPGKRQFLVEAKEIRDVLANEKGTESVIGISFDISKIETLSISKRAFNRMRNLKFLNFYNGSVSLLEDMEYLPRLRLLYWGSYPRKSLPLTFKPECLVELYMGFSKLEKLWGGIQPLTNLKKINLGYSSNLKEIPNLSKATNLKTLTLTGCESLVEIPSSIWNLQKLEMLYASGCIKLQVIPTNINLASLEEVNMSNCSRLRSFPDISSNIKRLYVAGTMIKEFPASIVGHWCRLDFLQIGSRSLKRLTHVPESVTHLDLRNSDIKMIPDCVIGLPHLVSLLVENCTKLVSIQGHSPSLVTLFADHCISLKSVCCSFHGPISKLMFYNCLKLDKESKRGIIQQSGNKSICLPGKEIPAEFTHQTIGNLITISLAPGCEEAYSTFSRFKACLLLSPIKNFAFNKINCFLRSKGVEISRTTESIYPFVSGGSLSEHLFIFCGDLFPEENRSLMDVTPNEILFDFSSSDVEIVECGVKIF

HMMPanther: PTHR11017
1-841 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MDQSFGIYSNRSWRTLSKLFFFFFSWLNEANEAELIQKIATDVSNKLNLTPSRDFEGMVGLEAHLTKLDSFLCLESDDVKMIGIWGPAGIGKTTIARALFNQLSTGFRLSCFMGTIDVNDYDSKLCLQNKLLSKILNQKDMKIHHLGAIEEWLHNQRVLIVLDDVDDLEQLEVLAKESSWFGHGSRIIVSLNDRKILKAHGINDIYDVDFPSEEEALEILCLSAFKQNSPQDGFEEVAKRVVELCGKLPLGLRVVGSSFYGESEDEWRIQLYGIETNLDRKIENVLRVGYDKLSERHQSLFLHIACFFNHKSVDYVTTMLADSTLDVENGLKTLAAKSLVSTNGWITMHCLLQQLGRQVVVQQGDPGKRQFLVEAKEIRDVLANEKGTESVIGISFDISKIETLSISKRAFNRMRNLKFLNFYNGSVSLLEDMEYLPRLRLLYWGSYPRKSLPLTFKPECLVELYMGFSKLEKLWGGIQPLTNLKKINLGYSSNLKEIPNLSKATNLKTLTLTGCESLVEIPSSIWNLQKLEMLYASGCIKLQVIPTNINLASLEEVNMSNCSRLRSFPDISSNIKRLYVAGTMIKEFPASIVGHWCRLDFLQIGSRSLKRLTHVPESVTHLDLRNSDIKMIPDCVIGLPHLVSLLVENCTKLVSIQGHSPSLVTLFADHCISLKSVCCSFHGPISKLMFYNCLKLDKESKRGIIQQSGNKSICLPGKEIPAEFTHQTIGNLITISLAPGCEEAYSTFSRFKACLLLSPIKNFAFNKINCFLRSKGVEISRTTESIYPFVSGGSLSEHLFIFCGDLFPEENRSLMDVTPNEILFDFSSSDVEIVECGVKIF

superfamily: SSF52540
41-282 SSF52540

TDVSNKLNLTPSRDFEGMVGLEAHLTKLDSFLCLESDDVKMIGIWGPAGIGKTTIARALFNQLSTGFRLSCFMGTIDVNDYDSKLCLQNKLLSKILNQKDMKIHHLGAIEEWLHNQRVLIVLDDVDDLEQLEVLAKESSWFGHGSRIIVSLNDRKILKAHGINDIYDVDFPSEEEALEILCLSAFKQNSPQDGFEEVAKRVVELCGKLPLGLRVVGSSFYGESEDEWRIQLYGIETNLDRKI

Gene3D: G3DSA:3.40.50.300
53-95 G3DSA:3.40.50.300

RDFEGMVGLEAHLTKLDSFLCLESDDVKMIGIWGPAGIGKTTI

HMMPfam: PF00931
IPR002182
62-314 NB-ARC,NBS
NB-ARC

EAHLTKLDSFLCLESDDVKMIGIWGPAGIGKTTIARALFNQLSTGFRLSCFMGTIDVNDYDSKLCLQNKLLSKILNQKDMKIHHLGAIEEWLHNQRVLIVLDDVDDLEQLEVLAKESSWFGHGSRIIVSLNDRKILKAHGINDIYDVDFPSEEEALEILCLSAFKQNSPQDGFEEVAKRVVELCGKLPLGLRVVGSSFYGESEDEWRIQLYGIETNLDRKIENVLRVGYDKLSERHQSLFLHIACFFNHKSVD

HMMSmart: SM00382
IPR003593
78-211 AAA,NBS
AAA+ ATPase domain

DVKMIGIWGPAGIGKTTIARALFNQLSTGFRLSCFMGTIDVNDYDSKLCLQNKLLSKILNQKDMKIHHLGAIEEWLHNQRVLIVLDDVDDLEQLEVLAKESSWFGHGSRIIVSLNDRKILKAHGINDIYDVDFP

FPrintScan: PR00364
IPR000767
81-96 DISEASERSIST
Disease resistance protein

MIGIWGPAGIGKTTIA

Gene3D: G3DSA:3.40.50.300
96-169 G3DSA:3.40.50.300

ARALFNQLSTGFRLSCFMGTIDVNDYDSKLCLQNKLLSKILNQKDMKIHHLGAIEEWLHNQRVLIVLDDVDDLE

FPrintScan: PR00364
IPR000767
152-166 DISEASERSIST
Disease resistance protein

WLHNQRVLIVLDDVD

FPrintScan: PR00364
IPR000767
245-259 DISEASERSIST
Disease resistance protein

CGKLPLGLRVVGSSF

superfamily: SSF46785
280-383 SSF46785

RKIENVLRVGYDKLSERHQSLFLHIACFFNHKSVDYVTTMLADSTLDVENGLKTLAAKSLVSTNGWITMHCLLQQLGRQVVVQQGDPGKRQFLVEAKEIRDVLA

superfamily: SSF52058
373-696 SSF52058,LRR

VEAKEIRDVLANEKGTESVIGISFDISKIETLSISKRAFNRMRNLKFLNFYNGSVSLLEDMEYLPRLRLLYWGSYPRKSLPLTFKPECLVELYMGFSKLEKLWGGIQPLTNLKKINLGYSSNLKEIPNLSKATNLKTLTLTGCESLVEIPSSIWNLQKLEMLYASGCIKLQVIPTNINLASLEEVNMSNCSRLRSFPDISSNIKRLYVAGTMIKEFPASIVGHWCRLDFLQIGSRSLKRLTHVPESVTHLDLRNSDIKMIPDCVIGLPHLVSLLVENCTKLVSIQGHSPSLVTLFADHCISLKSVCCSFHGPISKLMFYNCLKL

Gene3D: G3DSA:3.80.10.10
397-671 G3DSA:3.80.10.10

DISKIETLSISKRAFNRMRNLKFLNFYNGSVSLLEDMEYLPRLRLLYWGSYPRKSLPLTFKPECLVELYMGFSKLEKLWGGIQPLTNLKKINLGYSSNLKEIPNLSKATNLKTLTLTGCESLVEIPSSIWNLQKLEMLYASGCIKLQVIPTNINLASLEEVNMSNCSRLRSFPDISSNIKRLYVAGTMIKEFPASIVGHWCRLDFLQIGSRSLKRLTHVPESVTHLDLRNSDIKMIPDCVIGLPHLVSLLVENCTKLVSIQGHSPSLVTLFADHC

HMMPfam: PF07725
IPR011713
460-479 LRR_3
Leucine-rich repeat 3

CLVELYMGFSKLEKLWGGIQ

HMMPfam: PF00560
IPR001611
506-528 LRR_1
Leucine-rich repeat

NLKTLTLTGCESLVEIPSSIWNL

FPrintScan: PR00364
IPR000767
549-565 DISEASERSIST
Disease resistance protein

INLASLEEVNMSNCSRL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox