PRGDB00049062 (At1g56520/F25P12_23)

From PRG Wiki
Jump to: navigation, search
At1g56520/F25P12_23
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 26450899 (AK117919)
Gene Class Other
Domain Type LRR, LRR, LRR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana At1g56520 mRNA for putative disease resistance protein, complete cds, clone: RAFL19-10-H18.

DNA Sequence

ATGATCTTTTGTCTATCTGCTTTTAGACAACCCTCTCCACCTTATGGTTTTTTGAAGCTTACATATGAAGTTGCAAGTATTTGTGGTAATCTTCCATTGGGTCTGCATGTTTTGGGGACGTTATTGTGGGGAAAAAGTCAGGCTGACTGGATTGAAGAACTACCAAGGTTGAAAGACTGTCTTGATGGAAGAATTGAGAGTGTATTGAAAGTTGGCTATGAGAGTTTATATGAGAAAGACCAAGCTCTTTTTCTCCTCATTGCAGTCTACTTCAATTATGATTATGTTGATTATGTGACATCCATGCTAGAAAATACTAACGTATTGGATGTTAGACTTGGGTTGAAAAAACTAGCTAATAGATGTCTTATACAAATAGATATAGACCATAATCGCAAAAGTAGAGTCGTAATGAACCGGTTGCTACAAGTAATGGCTCGAGAAGTTATTTCCAAACAAAAAATTTCCAAACGAAAGATTCTAGAAGATCCCCAGGATATTTGTTATGTTCTAGAAGAGGCAAAGGGTAAAGGATCAGCTTTAGGATTATCATTGGACGTAGCAGAGATCAAAGAATTAGTAATAAACAAAAAGGCTTTTAAAAAAATGTGCAATCTTCTCATCTTAAAAGTCTTTAATGGGACGGATCCCCGAGATAGTAAATTGCACGTACCAGAGGAGATGGAGCTTCCATCTAGCATAAGGTTACTACATTGGGAGGCATACCCGAGAAAATCTTTTAGATTTGGTCCAGAAAATCTCGTCACACTCAACATGGAGTACAGTGAGCTCGAGAAGCTATGGAAAGGAACTCAGCCACTTGCAAATCTCAAGGAGATGAACTTGTGTGGGTCATCTTGTTTGAAGGAACTCCCAGATCTTTCGAAAGCAGCAAATCTGGAGAGATTGGATGTGGCTGAGTGCAATGCTTTGGTAGAGATTCCATCCTCAGTTGCGAATCTTCACAAAATAGTTAACTTACACATGGAATCCTGTGAAAGTCTAGAAGTCATTCCAACTCTCATCAACTTGGCATCTCTTAAGATTATCAACATACATGATTGCCCACGGTTGAAAAGTTTTCCAGATGTTCCCACCAGCCTCGAGGAACTTGTGATAGAGAAAACAGGGGTACAAGAATTGCCTGCATCATTTAGGCATTGCACTGGTGTTACTACTCTTTATATATGTTCCAATAGAAATCTCAAGACCTTCTCAACACATCTCCCCATGGGTCTAAGGAAGCTAGACCTAAGCAATTGTGGTATTGAGTGGGTTACAGATAGCATCAAAGATCTTCATAATCTATATTACCTTAAACTATCAGGCTGCAAAAGACTTGTGTCTTTGCCAGAACTCCCTTGTTCGCTCGAGTGTCTATTTGCAGAGGATTGTACATCACTAGAAAGAGTAAGTGACTCTCTAAACATTCCAAATGCGCAGTTCAATTTCATCAAATGCTTCACATTGGATAGAGAAGCACGACGAGCGATTATTCAACAATCGTTTGTTCATGGGAATGTTATCTTACCAGCAAGAGAAGTACTTGAAGAAGTCGATTACCGAGCGAGAGGAAATTGCTTAACAATTCCTCCTTCTGCTTTCAACAGATTTAAGGTTTGCGTTGTGTTGTCAATTCACTAG


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Arabidopsis thaliana].

MIFCLSAFRQPSPPYGFLKLTYEVASICGNLPLGLHVLGTLLWGKSQADWIEELPRLKDCLDGRIESVLKVGYESLYEKDQALFLLIAVYFNYDYVDYVTSMLENTNVLDVRLGLKKLANRCLIQIDIDHNRKSRVVMNRLLQVMAREVISKQKISKRKILEDPQDICYVLEEAKGKGSALGLSLDVAEIKELVINKKAFKKMCNLLILKVFNGTDPRDSKLHVPEEMELPSSIRLLHWEAYPRKSFRFGPENLVTLNMEYSELEKLWKGTQPLANLKEMNLCGSSCLKELPDLSKAANLERLDVAECNALVEIPSSVANLHKIVNLHMESCESLEVIPTLINLASLKIINIHDCPRLKSFPDVPTSLEELVIEKTGVQELPASFRHCTGVTTLYICSNRNLKTFSTHLPMGLRKLDLSNCGIEWVTDSIKDLHNLYYLKLSGCKRLVSLPELPCSLECLFAEDCTSLERVSDSLNIPNAQFNFIKCFTLDREARRAIIQQSFVHGNVILPAREVLEEVDYRARGNCLTIPPSAFNRFKVCVVLSIH

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017
1-546 PTHR11017,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MIFCLSAFRQPSPPYGFLKLTYEVASICGNLPLGLHVLGTLLWGKSQADWIEELPRLKDCLDGRIESVLKVGYESLYEKDQALFLLIAVYFNYDYVDYVTSMLENTNVLDVRLGLKKLANRCLIQIDIDHNRKSRVVMNRLLQVMAREVISKQKISKRKILEDPQDICYVLEEAKGKGSALGLSLDVAEIKELVINKKAFKKMCNLLILKVFNGTDPRDSKLHVPEEMELPSSIRLLHWEAYPRKSFRFGPENLVTLNMEYSELEKLWKGTQPLANLKEMNLCGSSCLKELPDLSKAANLERLDVAECNALVEIPSSVANLHKIVNLHMESCESLEVIPTLINLASLKIINIHDCPRLKSFPDVPTSLEELVIEKTGVQELPASFRHCTGVTTLYICSNRNLKTFSTHLPMGLRKLDLSNCGIEWVTDSIKDLHNLYYLKLSGCKRLVSLPELPCSLECLFAEDCTSLERVSDSLNIPNAQFNFIKCFTLDREARRAIIQQSFVHGNVILPAREVLEEVDYRARGNCLTIPPSAFNRFKVCVVLSI

HMMPanther: PTHR11017:SF20
1-546 PTHR11017:SF20,SUBFAMILY NOT NAMED

MIFCLSAFRQPSPPYGFLKLTYEVASICGNLPLGLHVLGTLLWGKSQADWIEELPRLKDCLDGRIESVLKVGYESLYEKDQALFLLIAVYFNYDYVDYVTSMLENTNVLDVRLGLKKLANRCLIQIDIDHNRKSRVVMNRLLQVMAREVISKQKISKRKILEDPQDICYVLEEAKGKGSALGLSLDVAEIKELVINKKAFKKMCNLLILKVFNGTDPRDSKLHVPEEMELPSSIRLLHWEAYPRKSFRFGPENLVTLNMEYSELEKLWKGTQPLANLKEMNLCGSSCLKELPDLSKAANLERLDVAECNALVEIPSSVANLHKIVNLHMESCESLEVIPTLINLASLKIINIHDCPRLKSFPDVPTSLEELVIEKTGVQELPASFRHCTGVTTLYICSNRNLKTFSTHLPMGLRKLDLSNCGIEWVTDSIKDLHNLYYLKLSGCKRLVSLPELPCSLECLFAEDCTSLERVSDSLNIPNAQFNFIKCFTLDREARRAIIQQSFVHGNVILPAREVLEEVDYRARGNCLTIPPSAFNRFKVCVVLSI

FPrintScan: PR00364
IPR000767
28-42 DISEASERSIST
Disease resistance protein

CGNLPLGLHVLGTLL

superfamily: SSF46785
63-172 SSF46785

GRIESVLKVGYESLYEKDQALFLLIAVYFNYDYVDYVTSMLENTNVLDVRLGLKKLANRCLIQIDIDHNRKSRVVMNRLLQVMAREVISKQKISKRKILEDPQDICYVLE

superfamily: SSF52058
167-482 SSF52058,LRR

ICYVLEEAKGKGSALGLSLDVAEIKELVINKKAFKKMCNLLILKVFNGTDPRDSKLHVPEEMELPSSIRLLHWEAYPRKSFRFGPENLVTLNMEYSELEKLWKGTQPLANLKEMNLCGSSCLKELPDLSKAANLERLDVAECNALVEIPSSVANLHKIVNLHMESCESLEVIPTLINLASLKIINIHDCPRLKSFPDVPTSLEELVIEKTGVQELPASFRHCTGVTTLYICSNRNLKTFSTHLPMGLRKLDLSNCGIEWVTDSIKDLHNLYYLKLSGCKRLVSLPELPCSLECLFAEDCTSLERVSDSLNIPNAQF

Gene3D: G3DSA:3.80.10.10
185-477 G3DSA:3.80.10.10

LDVAEIKELVINKKAFKKMCNLLILKVFNGTDPRDSKLHVPEEMELPSSIRLLHWEAYPRKSFRFGPENLVTLNMEYSELEKLWKGTQPLANLKEMNLCGSSCLKELPDLSKAANLERLDVAECNALVEIPSSVANLHKIVNLHMESCESLEVIPTLINLASLKIINIHDCPRLKSFPDVPTSLEELVIEKTGVQELPASFRHCTGVTTLYICSNRNLKTFSTHLPMGLRKLDLSNCGIEWVTDSIKDLHNLYYLKLSGCKRLVSLPELPCSLECLFAEDCTSLERVSDSLNI

HMMPfam: PF07725
IPR011713
253-272 LRR_3
Leucine-rich repeat 3

NLVTLNMEYSELEKLWKGTQ

HMMPfam: PF13504
413-424 LRR_7,Leucine rich repeat

LRKLDLSNCGIE

FPrintScan: PR00364
IPR000767
431-447 DISEASERSIST
Disease resistance protein

KDLHNLYYLKLSGCKRL

HMMPfam: PF00560
IPR001611
435-453 LRR_1
Leucine-rich repeat

NLYYLKLSGCKRLVSLPEL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox