PRGDB00049065 (At3g11010/F9F8_17)

From PRG Wiki
Jump to: navigation, search
At3g11010/F9F8_17
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 26449946 (AK117429)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana At3g11010 mRNA for putative disease resistance protein, complete cds, clone: RAFL17-03-J22.

DNA Sequence

ATGGTTGGCATTGAATCTCATCGGAAGACGGAGTCATGGGGGAATAACAGCGACTGTTGTAATTGGGAGGGAGTCACGTGCAATGCCAAGTCCGGGGAAGTGATCGAGCTCAACCTTAGCTGCAGCTCCCTCCATGGCCGGTTTCATTCCAACAGCAGTATTCGAAACCTTCATTTCCTAACCACTCTAGACCGTTCACATAATGATTTTGAAGGTCAAATCACGTCTTCAATTGAAAATCTGTCTCATCTCACCTCTCTCGACCTTTCTTATAATCGTTTTTCGGGTCAGATTCTGAATTCAATCGGAAACCTTTCTCGTCTCACCTCTCTCGACCTTTCTTTTAATCAGTTTTCGGGTCAGATTCCATCATCAATTGATAATCTTTCTCATCTCACCTTTCTAGGTCTTTCTGGTAATCGTTTTTTTGGTCAGATTCCATCTTCAATTGGTAATCTTTCTCATCTCACCTTTCTAGGTCTTTCTGGTAATCGTTTTTTTGGTCAGTTTCCGTCTTCAATTGGAGGTCTTTCTAATCTCACCAATCTCCACCTTTCTTATAACAAATATTCGGGTCAGATTCCATCTTCGATTGGCAACCTTTCTCAACTTATCGTTCTCTACCTTTCTGTTAACAATTTCTATGGTGAAATCCCATCTTCTTTTGGCAATCTAAACCAGCTGACCCGCTTAGATGTTTCTTTCAACAAGCTCGGTGGAAACTTTCCCAATGTCCTACTAAACTTGACAGGGTTGTCAGTTGTATCACTCTCCAACAATAAGTTCACAGGCACGCTTCCTCCTAATATCACTTCACTATCCAACTTGATGGCTTTTTATGCAAGTGACAACGCCTTCACCGGAACATTCCCTTCTTTTCTCTTCATCATTCCTTCTTTGACTTACCTTGGTTTGAGTGGTAACCAACTCAAAGGCACTCTTGAGTTTGGGAATATATCTTCACCATCTAACCTACAATACCTTAACATTGGCAGCAACAACTTCATAGGACCAATCCCGAGTTCCATTTCCAAATTAATCAACCTTCAGGAACTTGGCATTTCCCATTTAAACACCCAATGTCGCCCAGTTGACTTTAGTATCTTCTCGCATCTCAAGTCGCTTGACGATCTTAGGCTATCCTATTTGACCACCACTACGATTGACTTGAACGATATCTTACCATATTTCAAGACGCTCCGTTCATTGGATCTCTCAGGCAACCTTGTTTCAGCCACAAACAAGTCTTCAGTTTCTTCAGATCCTCCTTCGCAATCGATACAATCTTTGTACTTGTCAGGATGCGGTATCACCGATTTTCCAGAGATCCTAAGAACACAACACGAATTGGGGTTTCTAGACGTTTCCAACAACAAAATCAAAGGTCAAGTTCCTGGCTGGTTATGGACGCTACCAAACTTGTTCTACTTGAATCTTTCCAACAACACTTTCATCGGTTTCCAAAGACCAACGAAACCTGAACCATCTATGGCGTACTTGCTTGGCTCCAACAATAACTTCACCGGCAAGATTCCTTCTTTCATATGTGAGTTGCGTTCTCTATACACTCTCGATTTATCAGACAACAACTTTAGCGGTTCAATCCCTCGTTGTATGGAAAATCTCAAGAGTAATCTTTCAGAACTAAACCTTCGTCAAAATAATCTTAGTGGAGGTTTTCCAGAGCATATTTTCGAAAGTCTAAGGTCGCTTGATGTCGGCCATAACCAGCTTGTGGGAAAGCTTCCAAGATCTTTGAGATTTTTCTCTAATCTTGAAGTTTTGAACGTGGAAAGCAACAGAATCAACGACATGTTTCCGTTCTGGTTGAGTTCTCTACAAAAGCTACAAGTTCTTGTCCTTCGCTCCAATGCATTCCATGGACCAATAAATCAAGCCTTGTTCCCTAAGTTGCGAATCATCGACATATCACATAATCACTTCAATGGAAGTTTGCCGACAGAGTATTTTGTGGAGTGGAGTAGGATGTCATCACTTGGGACATACGAAGATGGGTCGAATGTAAACTACCTGGGATCAGGCTATTACCAAGATTCAATGGTTTTGATGAATAAAGGTGTAGAGTCGGAGCTGGTACGTATCCTCACAATCTACACAGCAGTCGACTTTTCGGGAAACAAATTTGAAGGAGAGATTCCAAAGTCCATCGGTCTATTGAAAGAGCTTCATGTGCTCAACTTGTCAAACAATACTTTCACCGGCCACATCCCTTCATCTATAGGGAACCTGACAGCTCTCGAGTCGTTGGACGTTTCCCAGAACAAGCTTTATGGAGAAATCCCACAAGAGATAGGGAACCTCTCGTTGCTTTCGTATATGAACTTCTCTCATAACCAGCTTACAGGCCTAGTACCAGGAGGCCAGCAGTTTCTAACGCAGCGTTGCTCTTCCTTTGAAGGTAACTTGGGACTTTTCGGCTCTTCTCTTGAAGAAGTTTGCAGAGATATTCACACGCCAGCATCACATCAACAGTTTGAAACGCCGCAAACAGAGGAAGAAGACGAAGATCTGATTAGTTGGATAGCAGCTGCAATAGGATTCGGACCTGGTATTGCCTTTGGTTTGATGTTTGGATACATACTCGTTTCCTATAAACCAGAGTGGTTCATGAACCCTTTTGGCCGAAACAATCGTAGACGGAAAAGACACACAACAACTCACTAG


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Arabidopsis thaliana].

MVGIESHRKTESWGNNSDCCNWEGVTCNAKSGEVIELNLSCSSLHGRFHSNSSIRNLHFLTTLDRSHNDFEGQITSSIENLSHLTSLDLSYNRFSGQILNSIGNLSRLTSLDLSFNQFSGQIPSSIDNLSHLTFLGLSGNRFFGQIPSSIGNLSHLTFLGLSGNRFFGQFPSSIGGLSNLTNLHLSYNKYSGQIPSSIGNLSQLIVLYLSVNNFYGEIPSSFGNLNQLTRLDVSFNKLGGNFPNVLLNLTGLSVVSLSNNKFTGTLPPNITSLSNLMAFYASDNAFTGTFPSFLFIIPSLTYLGLSGNQLKGTLEFGNISSPSNLQYLNIGSNNFIGPIPSSISKLINLQELGISHLNTQCRPVDFSIFSHLKSLDDLRLSYLTTTTIDLNDILPYFKTLRSLDLSGNLVSATNKSSVSSDPPSQSIQSLYLSGCGITDFPEILRTQHELGFLDVSNNKIKGQVPGWLWTLPNLFYLNLSNNTFIGFQRPTKPEPSMAYLLGSNNNFTGKIPSFICELRSLYTLDLSDNNFSGSIPRCMENLKSNLSELNLRQNNLSGGFPEHIFESLRSLDVGHNQLVGKLPRSLRFFSNLEVLNVESNRINDMFPFWLSSLQKLQVLVLRSNAFHGPINQALFPKLRIIDISHNHFNGSLPTEYFVEWSRMSSLGTYEDGSNVNYLGSGYYQDSMVLMNKGVESELVRILTIYTAVDFSGNKFEGEIPKSIGLLKELHVLNLSNNTFTGHIPSSIGNLTALESLDVSQNKLYGEIPQEIGNLSLLSYMNFSHNQLTGLVPGGQQFLTQRCSSFEGNLGLFGSSLEEVCRDIHTPASHQQFETPQTEEEDEDLISWIAAAIGFGPGIAFGLMFGYILVSYKPEWFMNPFGRNNRRRKRHTTTH


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF916
1-887 PTHR24420:SF916

MVGIESHRKTESWGNNSDCCNWEGVTCNAKSGEVIELNLSCSSLHGRFHSNSSIRNLHFLTTLDRSHNDFEGQITSSIENLSHLTSLDLSYNRFSGQILNSIGNLSRLTSLDLSFNQFSGQIPSSIDNLSHLTFLGLSGNRFFGQIPSSIGNLSHLTFLGLSGNRFFGQFPSSIGGLSNLTNLHLSYNKYSGQIPSSIGNLSQLIVLYLSVNNFYGEIPSSFGNLNQLTRLDVSFNKLGGNFPNVLLNLTGLSVVSLSNNKFTGTLPPNITSLSNLMAFYASDNAFTGTFPSFLFIIPSLTYLGLSGNQLKGTLEFGNISSPSNLQYLNIGSNNFIGPIPSSISKLINLQELGISHLNTQCRPVDFSIFSHLKSLDDLRLSYLTTTTIDLNDILPYFKTLRSLDLSGNLVSATNKSSVSSDPPSQSIQSLYLSGCGITDFPEILRTQHELGFLDVSNNKIKGQVPGWLWTLPNLFYLNLSNNTFIGFQRPTKPEPSMAYLLGSNNNFTGKIPSFICELRSLYTLDLSDNNFSGSIPRCMENLKSNLSELNLRQNNLSGGFPEHIFESLRSLDVGHNQLVGKLPRSLRFFSNLEVLNVESNRINDMFPFWLSSLQKLQVLVLRSNAFHGPINQALFPKLRIIDISHNHFNGSLPTEYFVEWSRMSSLGTYEDGSNVNYLGSGYYQDSMVLMNKGVESELVRILTIYTAVDFSGNKFEGEIPKSIGLLKELHVLNLSNNTFTGHIPSSIGNLTALESLDVSQNKLYGEIPQEIGNLSLLSYMNFSHNQLTGLVPGGQQFLTQRCSSFEGNLGLFGSSLEEVCRDIHTPASHQQFETPQTEEEDEDLISWIAAAIGFGPGIAFGLMFGYILVSYKPEWFMNPFGRNNRRR

HMMPanther: PTHR24420
1-887 PTHR24420,FAMILY NOT NAMED

MVGIESHRKTESWGNNSDCCNWEGVTCNAKSGEVIELNLSCSSLHGRFHSNSSIRNLHFLTTLDRSHNDFEGQITSSIENLSHLTSLDLSYNRFSGQILNSIGNLSRLTSLDLSFNQFSGQIPSSIDNLSHLTFLGLSGNRFFGQIPSSIGNLSHLTFLGLSGNRFFGQFPSSIGGLSNLTNLHLSYNKYSGQIPSSIGNLSQLIVLYLSVNNFYGEIPSSFGNLNQLTRLDVSFNKLGGNFPNVLLNLTGLSVVSLSNNKFTGTLPPNITSLSNLMAFYASDNAFTGTFPSFLFIIPSLTYLGLSGNQLKGTLEFGNISSPSNLQYLNIGSNNFIGPIPSSISKLINLQELGISHLNTQCRPVDFSIFSHLKSLDDLRLSYLTTTTIDLNDILPYFKTLRSLDLSGNLVSATNKSSVSSDPPSQSIQSLYLSGCGITDFPEILRTQHELGFLDVSNNKIKGQVPGWLWTLPNLFYLNLSNNTFIGFQRPTKPEPSMAYLLGSNNNFTGKIPSFICELRSLYTLDLSDNNFSGSIPRCMENLKSNLSELNLRQNNLSGGFPEHIFESLRSLDVGHNQLVGKLPRSLRFFSNLEVLNVESNRINDMFPFWLSSLQKLQVLVLRSNAFHGPINQALFPKLRIIDISHNHFNGSLPTEYFVEWSRMSSLGTYEDGSNVNYLGSGYYQDSMVLMNKGVESELVRILTIYTAVDFSGNKFEGEIPKSIGLLKELHVLNLSNNTFTGHIPSSIGNLTALESLDVSQNKLYGEIPQEIGNLSLLSYMNFSHNQLTGLVPGGQQFLTQRCSSFEGNLGLFGSSLEEVCRDIHTPASHQQFETPQTEEEDEDLISWIAAAIGFGPGIAFGLMFGYILVSYKPEWFMNPFGRNNRRR

HMMPfam: PF08263
IPR013210
6-28 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

SHRKTESWGNNSDCCNWEGVTCN

Gene3D: G3DSA:3.80.10.10
11-238 G3DSA:3.80.10.10

ESWGNNSDCCNWEGVTCNAKSGEVIELNLSCSSLHGRFHSNSSIRNLHFLTTLDRSHNDFEGQITSSIENLSHLTSLDLSYNRFSGQILNSIGNLSRLTSLDLSFNQFSGQIPSSIDNLSHLTFLGLSGNRFFGQIPSSIGNLSHLTFLGLSGNRFFGQFPSSIGGLSNLTNLHLSYNKYSGQIPSSIGNLSQLIVLYLSVNNFYGEIPSSFGNLNQLTRLDVSFNKL

superfamily: SSF52047
36-376 SSF52047,LRR

ELNLSCSSLHGRFHSNSSIRNLHFLTTLDRSHNDFEGQITSSIENLSHLTSLDLSYNRFSGQILNSIGNLSRLTSLDLSFNQFSGQIPSSIDNLSHLTFLGLSGNRFFGQIPSSIGNLSHLTFLGLSGNRFFGQFPSSIGGLSNLTNLHLSYNKYSGQIPSSIGNLSQLIVLYLSVNNFYGEIPSSFGNLNQLTRLDVSFNKLGGNFPNVLLNLTGLSVVSLSNNKFTGTLPPNITSLSNLMAFYASDNAFTGTFPSFLFIIPSLTYLGLSGNQLKGTLEFGNISSPSNLQYLNIGSNNFIGPIPSSISKLINLQELGISHLNTQCRPVDFSIFSHLKSLD

HMMPfam: PF13516
81-104 LRR_6,Leucine Rich repeat

LSHLTSLDLSYNRFSGQILNSIGN

HMMPfam: PF13516
105-126 LRR_6,Leucine Rich repeat

LSRLTSLDLSFNQFSGQIPSSI

HMMPfam: PF00560
IPR001611
131-153 LRR_1
Leucine-rich repeat

HLTFLGLSGNRFFGQIPSSIGNL

HMMPfam: PF13504
154-171 LRR_7,Leucine rich repeat

SHLTFLGLSGNRFFGQFP

HMMPfam: PF13855
178-238 LRR_8,Leucine rich repeat

SNLTNLHLSYNKYSGQIPSSIGNLSQLIVLYLSVNNFYGEIPSSFGNLNQLTRLDVSFNKL

Gene3D: G3DSA:3.80.10.10
239-484 G3DSA:3.80.10.10

GGNFPNVLLNLTGLSVVSLSNNKFTGTLPPNITSLSNLMAFYASDNAFTGTFPSFLFIIPSLTYLGLSGNQLKGTLEFGNISSPSNLQYLNIGSNNFIGPIPSSISKLINLQELGISHLNTQCRPVDFSIFSHLKSLDDLRLSYLTTTTIDLNDILPYFKTLRSLDLSGNLVSATNKSSVSSDPPSQSIQSLYLSGCGITDFPEILRTQHELGFLDVSNNKIKGQVPGWLWTLPNLFYLNLSNNTF

HMMPfam: PF13504
298-311 LRR_7,Leucine rich repeat

PSLTYLGLSGNQLK

HMMPfam: PF00560
IPR001611
324-346 LRR_1
Leucine-rich repeat

NLQYLNIGSNNFIGPIPSSISKL

superfamily: SSF52058
425-808 SSF52058,LRR

QSIQSLYLSGCGITDFPEILRTQHELGFLDVSNNKIKGQVPGWLWTLPNLFYLNLSNNTFIGFQRPTKPEPSMAYLLGSNNNFTGKIPSFICELRSLYTLDLSDNNFSGSIPRCMENLKSNLSELNLRQNNLSGGFPEHIFESLRSLDVGHNQLVGKLPRSLRFFSNLEVLNVESNRINDMFPFWLSSLQKLQVLVLRSNAFHGPINQALFPKLRIIDISHNHFNGSLPTEYFVEWSRMSSLGTYEDGSNVNYLGSGYYQDSMVLMNKGVESELVRILTIYTAVDFSGNKFEGEIPKSIGLLKELHVLNLSNNTFTGHIPSSIGNLTALESLDVSQNKLYGEIPQEIGNLSLLSYMNFSHNQLTGLVPGGQQFLTQRCSSFEGN

HMMPfam: PF13855
426-482 LRR_8,Leucine rich repeat

SIQSLYLSGCGITDFPEILRTQHELGFLDVSNNKIKGQVPGWLWTLPNLFYLNLSNN

Gene3D: G3DSA:3.80.10.10
499-555 G3DSA:3.80.10.10

YLLGSNNNFTGKIPSFICELRSLYTLDLSDNNFSGSIPRCMENLKSNLSELNLRQNN

HMMPfam: PF00560
IPR001611
520-541 LRR_1
Leucine-rich repeat

SLYTLDLSDNNFSGSIPRCMEN

Gene3D: G3DSA:3.80.10.10
556-668 G3DSA:3.80.10.10

LSGGFPEHIFESLRSLDVGHNQLVGKLPRSLRFFSNLEVLNVESNRINDMFPFWLSSLQKLQVLVLRSNAFHGPINQALFPKLRIIDISHNHFNGSLPTEYFVEWSRMSSLGT

HMMPfam: PF13855
567-625 LRR_8,Leucine rich repeat

SLRSLDVGHNQLVGKLPRSLRFFSNLEVLNVESNRINDMFPFWLSSLQKLQVLVLRSNA

Gene3D: G3DSA:3.80.10.10
708-808 G3DSA:3.80.10.10

VDFSGNKFEGEIPKSIGLLKELHVLNLSNNTFTGHIPSSIGNLTALESLDVSQNKLYGEIPQEIGNLSLLSYMNFSHNQLTGLVPGGQQFLTQRCSSFEGN

HMMPfam: PF13855
728-787 LRR_8,Leucine rich repeat

ELHVLNLSNNTFTGHIPSSIGNLTALESLDVSQNKLYGEIPQEIGNLSLLSYMNFSHNQL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox