PRGDB00049077 (OSJNBa0034L04.44)

From PRG Wiki
Jump to: navigation, search
OSJNBa0034L04.44
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 16418166 (AC091680)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Oryza sativa Japonica Group

Comment?

Oryza sativa chromosome 10 BAC OSJNBa0034L04 genomic sequence, complete sequence.

DNA Sequence

ATGGCTCCCGTCGTCCACCGTTTCTTCCTCGTCGACGTCGTCGTCCTCTTCGCCGCGGCCGCGGCCGCTGCCATCCCTGCGTCGGCCGAAGCGGCAGCGTCGTCGTCGCAGACCGACGCGCTGCTGGCGTGGAAGGCCAGCCTGGACGACGCGGCCTCGCTGTCCGACTGGACGCGGGCCGCGCCGGTCTGCACCTGGCGCGGCGTGGCCTGCGACGCCGCCGGCAGCGTTGCCTCGCTCCGGCTCCGGAGCCTCCGCCTCCGCGGCGGCATCCACGCGCTCGACTTCGCGGCGCTCCCGGCGCTCACTGAGCTCGACCTCAACGACAACTACCTCGTCGGCGCGATCCCGGCCAGAATCTCGCGGCTGCGCTCACTCGCCTCGCTCGACCTCGGCAGCAACTGGTTCGACGGCTCCATCCCGCCGCAGTTCGGCGACCTCTCCGGCCTCGTCGACCTCCGCCTCTACAACAACAACCTCGTCGGCGCCATCCCGCACCAGCTCAGCCGGCTCCCCAAGATCGCCCATGTCGACCTGGGAGCAAACTACCTGACCGGGCTCGACTTCCGCAAGTTCTCGCCGATGCCCACCATGACGTTCCTGTCTCTTTTCCTCAACTCCCTCAACGGCAGCTTCCCGGAGTTCGTCATCCGCAGCGGCAACCTCACTTTCCTCGACCTGTCGCACAACAATTTCTCTGGGTCCATACCAGACATGCTGCCGGAAAAGCTCCCGAATCTGATGTACCTCAACTTGTCCTTCAACGCGTTCTCCGGTCAAATTCCGGCGTCGATCGGGAGGTTGACGAAGCTCCTGGACCTTCGGATTGACAGCAACAACCTCACCGGTGGCGTCCCGGTGTTCCTGGGGTCGATGTCGCAGTTGAAGGTTCTTGATCTCGGATTCAACCCGCTGGGCGGTACTATCCCACCTGTTCTTGGCCAGCTCCAGATGCTGCAGCAGCTCAGCATCATGAACGCCGAGCTCGTTTCAACTCTGCCGCCTGAGCTGGGAAATCTTAAGAATCTCACTGTCATGGAGCTGTCCATGAACCAGCTCTCCGGTGGATTGCCGCCGGAGTTCGCCGGGATGCAAGCAATGCGGGTGTTCAGCATTTCAACGAACAACCTCACCGGTGAGATCCCACCGGCGTTGTTCACGAGCTGGCCCGAGCTCATATCCTTCCAAGTGCAGAACAACTTGTTCACCGGCAAGATTCCGCCGGAGCTGGGAAAGGCAGGGAAACTGATAGTGTTGTTCATGTTTGGAAATAGATTATCAGGCAGCATACCCGCAGCATTAGGGAGTTTGACAAGCTTGGAGGATCTTGATTTGTCAGATAATGATCTGACAGGAGGTATTCCACCTGAGTTGGGTCATCTCAGCCATTTGACATTCCTGAAGCTGAGCCATAACTCCATTTCAGGACCGATTCCGGGAAATATGGGAAACAATTTCAAGATGCAGGGAGTTGATCATTCGTCAGGGAATTCCTCTAACAGCAGATCTGGTTCGGATTTCTGTCAACTGCTCTCCCTAAAGATCCTGTACCTGTCAAACAACAAGCTCACTGGTAAGCTGCCCGACTGCTGGTGGAACCTGCAAAATCTGCAGTTCATCGACTTGTCCAACAATGCATTCTCAGGTGAAATCCCTACAGTCCAGACGAACTACAACTGTTCTCTTGAATCGGTTCATCTTGCCGACAACGGCTTCACCGGTGTTTTTCCATCATCGTTAGAGATGTGTAAGGCGCTGATCACCCTAGATATTGGGAACAACAGATTCTTTGGAGGTATTCCTCCTTGGATTGGGAAAGGCCTTCTGTCGTTGAAGTTTCTTAGCCTGAAATCAAACAACTTCACAGGTGAAATCCCTTCAGAGTTGTCGAATCTCTCTCAACTTCAACTGTTAGACATAAGCAACAACGGTTTGACAGGATTGATTCCCAAATCTTTTGGCAACCTAACTTCCATGAAGAATCCAAATACTTTATCTGCTCAAGAAACATTAGAATGGTCTTCTTACATAAATTGGCTGCTTTACTCGGATGGAATCGATACAATCTGGAAGGGGCAAGAGCAATTTTTCGAAAAAACAATTGAATTACTAACGGGTATCAATTTGTCAGGAGCCATTCCTCCAAGCCTTGCTGATATATCTACTCTTGACATTCTAAATCTCTCGAATAATCATCTATCAGGTTTATTTTAA


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Oryza sativa (japonica cultivar-group)].

MAPVVHRFFLVDVVVLFAAAAAAAIPASAEAAASSSQTDALLAWKASLDDAASLSDWTRAAPVCTWRGVACDAAGSVASLRLRSLRLRGGIHALDFAALPALTELDLNDNYLVGAIPARISRLRSLASLDLGSNWFDGSIPPQFGDLSGLVDLRLYNNNLVGAIPHQLSRLPKIAHVDLGANYLTGLDFRKFSPMPTMTFLSLFLNSLNGSFPEFVIRSGNLTFLDLSHNNFSGSIPDMLPEKLPNLMYLNLSFNAFSGQIPASIGRLTKLLDLRIDSNNLTGGVPVFLGSMSQLKVLDLGFNPLGGTIPPVLGQLQMLQQLSIMNAELVSTLPPELGNLKNLTVMELSMNQLSGGLPPEFAGMQAMRVFSISTNNLTGEIPPALFTSWPELISFQVQNNLFTGKIPPELGKAGKLIVLFMFGNRLSGSIPAALGSLTSLEDLDLSDNDLTGGIPPELGHLSHLTFLKLSHNSISGPIPGNMGNNFKMQGVDHSSGNSSNSRSGSDFCQLLSLKILYLSNNKLTGKLPDCWWNLQNLQFIDLSNNAFSGEIPTVQTNYNCSLESVHLADNGFTGVFPSSLEMCKALITLDIGNNRFFGGIPPWIGKGLLSLKFLSLKSNNFTGEIPSELSNLSQLQLLDISNNGLTGLIPKSFGNLTSMKNPNTLSAQETLEWSSYINWLLYSDGIDTIWKGQEQFFEKTIELLTGINLSGAIPPSLADISTLDILNLSNNHLSGLF


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
14-735 PTHR24420,FAMILY NOT NAMED

VVLFAAAAAAAIPASAEAAASSSQTDALLAWKASLDDAASLSDWTRAAPVCTWRGVACDAAGSVASLRLRSLRLRGGIHALDFAALPALTELDLNDNYLVGAIPARISRLRSLASLDLGSNWFDGSIPPQFGDLSGLVDLRLYNNNLVGAIPHQLSRLPKIAHVDLGANYLTGLDFRKFSPMPTMTFLSLFLNSLNGSFPEFVIRSGNLTFLDLSHNNFSGSIPDMLPEKLPNLMYLNLSFNAFSGQIPASIGRLTKLLDLRIDSNNLTGGVPVFLGSMSQLKVLDLGFNPLGGTIPPVLGQLQMLQQLSIMNAELVSTLPPELGNLKNLTVMELSMNQLSGGLPPEFAGMQAMRVFSISTNNLTGEIPPALFTSWPELISFQVQNNLFTGKIPPELGKAGKLIVLFMFGNRLSGSIPAALGSLTSLEDLDLSDNDLTGGIPPELGHLSHLTFLKLSHNSISGPIPGNMGNNFKMQGVDHSSGNSSNSRSGSDFCQLLSLKILYLSNNKLTGKLPDCWWNLQNLQFIDLSNNAFSGEIPTVQTNYNCSLESVHLADNGFTGVFPSSLEMCKALITLDIGNNRFFGGIPPWIGKGLLSLKFLSLKSNNFTGEIPSELSNLSQLQLLDISNNGLTGLIPKSFGNLTSMKNPNTLSAQETLEWSSYINWLLYSDGIDTIWKGQEQFFEKTIELLTGINLSGAIPPSLADISTLDILNLSNNHLSG

HMMPanther: PTHR24420:SF504
14-735 PTHR24420:SF504,OS10G0469000 PROTEIN

VVLFAAAAAAAIPASAEAAASSSQTDALLAWKASLDDAASLSDWTRAAPVCTWRGVACDAAGSVASLRLRSLRLRGGIHALDFAALPALTELDLNDNYLVGAIPARISRLRSLASLDLGSNWFDGSIPPQFGDLSGLVDLRLYNNNLVGAIPHQLSRLPKIAHVDLGANYLTGLDFRKFSPMPTMTFLSLFLNSLNGSFPEFVIRSGNLTFLDLSHNNFSGSIPDMLPEKLPNLMYLNLSFNAFSGQIPASIGRLTKLLDLRIDSNNLTGGVPVFLGSMSQLKVLDLGFNPLGGTIPPVLGQLQMLQQLSIMNAELVSTLPPELGNLKNLTVMELSMNQLSGGLPPEFAGMQAMRVFSISTNNLTGEIPPALFTSWPELISFQVQNNLFTGKIPPELGKAGKLIVLFMFGNRLSGSIPAALGSLTSLEDLDLSDNDLTGGIPPELGHLSHLTFLKLSHNSISGPIPGNMGNNFKMQGVDHSSGNSSNSRSGSDFCQLLSLKILYLSNNKLTGKLPDCWWNLQNLQFIDLSNNAFSGEIPTVQTNYNCSLESVHLADNGFTGVFPSSLEMCKALITLDIGNNRFFGGIPPWIGKGLLSLKFLSLKSNNFTGEIPSELSNLSQLQLLDISNNGLTGLIPKSFGNLTSMKNPNTLSAQETLEWSSYINWLLYSDGIDTIWKGQEQFFEKTIELLTGINLSGAIPPSLADISTLDILNLSNNHLSG

Gene3D: G3DSA:3.80.10.10
35-230 G3DSA:3.80.10.10

SSQTDALLAWKASLDDAASLSDWTRAAPVCTWRGVACDAAGSVASLRLRSLRLRGGIHALDFAALPALTELDLNDNYLVGAIPARISRLRSLASLDLGSNWFDGSIPPQFGDLSGLVDLRLYNNNLVGAIPHQLSRLPKIAHVDLGANYLTGLDFRKFSPMPTMTFLSLFLNSLNGSFPEFVIRSGNLTFLDLSHN

HMMPfam: PF08263
IPR013210
35-72 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

SSQTDALLAWKASLDDAASLSDWTRAAPVCTWRGVACD

superfamily: SSF52047
79-138 SSF52047,LRR

SLRLRSLRLRGGIHALDFAALPALTELDLNDNYLVGAIPARISRLRSLASLDLGSNWFDG

HMMPfam: PF13504
100-113 LRR_7,Leucine rich repeat

PALTELDLNDNYLV

ProfileScan: PS51450
IPR001611
101-124 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALTELDLNDNYLVGAIPARISRLR

superfamily: SSF52047
139-491 SSF52047,LRR

SIPPQFGDLSGLVDLRLYNNNLVGAIPHQLSRLPKIAHVDLGANYLTGLDFRKFSPMPTMTFLSLFLNSLNGSFPEFVIRSGNLTFLDLSHNNFSGSIPDMLPEKLPNLMYLNLSFNAFSGQIPASIGRLTKLLDLRIDSNNLTGGVPVFLGSMSQLKVLDLGFNPLGGTIPPVLGQLQMLQQLSIMNAELVSTLPPELGNLKNLTVMELSMNQLSGGLPPEFAGMQAMRVFSISTNNLTGEIPPALFTSWPELISFQVQNNLFTGKIPPELGKAGKLIVLFMFGNRLSGSIPAALGSLTSLEDLDLSDNDLTGGIPPELGHLSHLTFLKLSHNSISGPIPGNMGNNFKMQGV

ProfileScan: PS51450
IPR001611
221-243 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLTFLDLSHNNFSGSIPDMLPEK

HMMPfam: PF13855
221-281 LRR_8,Leucine rich repeat

NLTFLDLSHNNFSGSIPDMLPEKLPNLMYLNLSFNAFSGQIPASIGRLTKLLDLRIDSNNL

FPrintScan: PR00019
222-235 LEURICHRPT,Leucine-rich repeat signature

LTFLDLSHNNFSGS

Gene3D: G3DSA:3.80.10.10
231-323 G3DSA:3.80.10.10

NFSGSIPDMLPEKLPNLMYLNLSFNAFSGQIPASIGRLTKLLDLRIDSNNLTGGVPVFLGSMSQLKVLDLGFNPLGGTIPPVLGQLQMLQQLS

ProfileScan: PS51450
IPR001611
246-268 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLMYLNLSFNAFSGQIPASIGRL

HMMPfam: PF13516
293-310 LRR_6,Leucine Rich repeat

SQLKVLDLGFNPLGGTIP

ProfileScan: PS51450
IPR001611
294-316 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLKVLDLGFNPLGGTIPPVLGQL

Gene3D: G3DSA:3.80.10.10
324-495 G3DSA:3.80.10.10

IMNAELVSTLPPELGNLKNLTVMELSMNQLSGGLPPEFAGMQAMRVFSISTNNLTGEIPPALFTSWPELISFQVQNNLFTGKIPPELGKAGKLIVLFMFGNRLSGSIPAALGSLTSLEDLDLSDNDLTGGIPPELGHLSHLTFLKLSHNSISGPIPGNMGNNFKMQGVDHSS

superfamily: SSF52058
386-737 SSF52058,LRR

FTSWPELISFQVQNNLFTGKIPPELGKAGKLIVLFMFGNRLSGSIPAALGSLTSLEDLDLSDNDLTGGIPPELGHLSHLTFLKLSHNSISGPIPGNMGNNFKMQGVDHSSGNSSNSRSGSDFCQLLSLKILYLSNNKLTGKLPDCWWNLQNLQFIDLSNNAFSGEIPTVQTNYNCSLESVHLADNGFTGVFPSSLEMCKALITLDIGNNRFFGGIPPWIGKGLLSLKFLSLKSNNFTGEIPSELSNLSQLQLLDISNNGLTGLIPKSFGNLTSMKNPNTLSAQETLEWSSYINWLLYSDGIDTIWKGQEQFFEKTIELLTGINLSGAIPPSLADISTLDILNLSNNHLSGLF

ProfileScan: PS51450
IPR001611
415-438 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLIVLFMFGNRLSGSIPAALGSLT

HMMPfam: PF13855
419-474 LRR_8,Leucine rich repeat

LFMFGNRLSGSIPAALGSLTSLEDLDLSDNDLTGGIPPELGHLSHLTFLKLSHNSI

FPrintScan: PR00019
437-450 LEURICHRPT,Leucine-rich repeat signature

LTSLEDLDLSDNDL

ProfileScan: PS51450
IPR001611
439-461 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLEDLDLSDNDLTGGIPPELGHL

ProfileScan: PS51450
IPR001611
463-485 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLTFLKLSHNSISGPIPGNMGNN

Gene3D: G3DSA:3.80.10.10
496-658 G3DSA:3.80.10.10

GNSSNSRSGSDFCQLLSLKILYLSNNKLTGKLPDCWWNLQNLQFIDLSNNAFSGEIPTVQTNYNCSLESVHLADNGFTGVFPSSLEMCKALITLDIGNNRFFGGIPPWIGKGLLSLKFLSLKSNNFTGEIPSELSNLSQLQLLDISNNGLTGLIPKSFGNLTS

ProfileScan: PS51450
IPR001611
512-534 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKILYLSNNKLTGKLPDCWWNL

HMMPfam: PF12799
512-548 LRR_4,Leucine Rich repeats (2 copies)

SLKILYLSNNKLTGKLPDCWWNLQNLQFIDLSNNAFS

ProfileScan: PS51450
IPR001611
536-558 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQFIDLSNNAFSGEIPTVQTNY

HMMPfam: PF12799
610-648 LRR_4,Leucine Rich repeats (2 copies)

SLKFLSLKSNNFTGEIPSELSNLSQLQLLDISNNGLTGL

ProfileScan: PS51450
IPR001611
610-633 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLKFLSLKSNNFTGEIPSELSNLS

ProfileScan: PS51450
IPR001611
634-655 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLQLLDISNNGLTGLIPKSFGN

Gene3D: G3DSA:3.80.10.10
704-736 G3DSA:3.80.10.10

LTGINLSGAIPPSLADISTLDILNLSNNHLSGL

ProfileScan: PS51450
IPR001611
722-737 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

TLDILNLSNNHLSGLF


List of References



List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox