PRGDB00049084 (F9E11.5)

From PRG Wiki
Jump to: navigation, search
F9E11.5
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 9989658 (AC079678)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana chromosome 1 BAC F9E11 genomic sequence, complete sequence.

DNA Sequence

ATGGAAGGGAAGGTGTTCTTGGGTCACAACCTGATATGGGTGATGCTACTGATGGGGCAGTTACATGGATACAAAAGTTGTATTGATGAAGAAAAGATCGCTTTGTTTGAGCTCAGGAAACACATGATCTCAAGAACTGAATCCGAGTCTGTTCTCCCTACTTGGACCAATGATACAACGAGCGATTGCTGTCGATGGAAGGGCGTTGCTTGCAATCGTGTAAGCGGACGGGTGACCGAGATTTCCTTTGGTGGACTGAGCCTAAAAGATAATTCTCTCCTAAATCTTTCTTTGTTGCATCCCTTTGAAGATGTTCGAAGTTTGAACTTATCAAGCTCCAGATGCAGTGGCTTGTTTGATGATGTGGAAGGTTATAAAAGCCTCAGAAAATTAAGAAAGTTGGAGATTCTGGATTTGGCTTCAAATAAATTCAACAACAGTATATTTCATTTTCTTAGTGCCGCTACATCACTCACAACTCTGTTTCTTAGGTCCAACAACATGGATGGCTCTTTTCCTGCTAAAGAACTTAGAGATTTGACAAACTTGGAATTACTAGACCTGAGTAGAAACAGATTTAACGGCTCCATACCAATACAAGAGTTATCTAGCCTAAGGAAGCTGAAAGCTCTTGATCTAAGTGGCAATGAATTTTCTGGCTCAATGGAATTACAAGGAAAGTTCTGCACTGATCTTTTATTTTCCATCCAGAGTGGGATTTGTGAATTGAATAATATGCAAGAGCTTGATCTCAGTCAAAACAAACTCGTAGGCCATCTCCCCTCATGTTTAACTAGCTTGACTGGCCTTCGAGTTCTTGACCTTTCATCGAACAAATTAACTGGGACGGTTCCTTCTTCTCTCGGTAGCCTACAATCCCTTGAGTACTTATCGTTGTTTGATAACGACTTTGAAGGTTCTTTCTCATTTGGTTCACTCGCCAACCTCTCAAACCTAATGGTGTTGAAACTTTGCTCAAAGTCCAGCTCTCTTCAAGTACTGTCCGAAAGTTCTTGGAAGCCAAAATTTCAGCTGAGTGTTATTGCGCTACGATCATGCAACATGGAGAAGGTTCCTCATTTTCTCCTACACCAGAAGGATTTGCGTCATGTTGATCTCTCCGACAATAATATCTCTGGAAAGCTTCCTTCTTGGTTATTGGCAAACAATACAAAACTCAAAGTTCTGCTTCTACAGAATAATCTCTTTACAAGCTTTCAGATACCTAAATCTGCTCATAATCTGCTTTTCCTCGATGTGTCAGCTAATGACTTCAACCATCTTTTTCCTGAGAACATTGGATGGATCTTTCCTCATTTACGATATCTGAATACATCCAAGAATAATTTTCAGGAGAACCTGCCATCTTCTCTTGGTAACATGAATGGTATCCAATATATGGACCTATCTCGCAACAGTTTCCACGGGAATCTACCAAGAAGTTTTGTGAATGGTTGTTATTCCATGGCGATCTTGAAGCTGTCACATAACAAACTAAGTGGAGAGATTTTTCCAGAATCAACCAACTTTACTAATATATTGGGGTTGTTTATGGATAACAATCTCTTTACAGGAAAGATTGGACAAGGTTTGCGGAGCTTGATAAACTTGGAACTGCTTGACATGTCAAACAACAATCTCACTGGTGTTATTCCAAGTTGGATTGGCGAGCTTCCATCCTTAACTGCACTTCTGATTTCAGACAACTTCTTGAAAGGTGACATACCTATGTCGTTGTTCAACAAATCAAGTCTCCAGCTGCTAGACCTCTCAGCAAACAGTTTATCTGGGGTCATACCTCCACAGCATGATTCAAGAAACGGGGTTGTCTTACTCCTACAAGACAATAAGTTATCAGGTACTATTCCAGACACATTGCTTGCAAATGTAGAAATTCTTGATCTGAGAAACAACAGATTCTCTGGAAAGATTCCGGAGTTCATCAACATTCAAAATATTAGTATTCTTCTTCTACGGGGGAATAACTTTACAGGCCAGATTCCTCACCAGTTGTGTGGTCTAAGTAACATCCAACTTCTTGATCTTTCCAACAACAGATTGAATGGAACCATACCTTCATGTCTCAGTAATACATCATTTGGTTTTGGTAAAGAATGTACATCATATGATTATGATTTCGGCATTTCTTTCCCTTCTGATGTCTTCAATGGTTTTTCTCTGCATCAAGACTTCTCTTCCAACAAAAATGGTGGTATATATTTCAAATCTCTGCTTACGCTTGATCCGTTAAGTATGGACTACAAGGCAGCCACACAGACGAAAATCGAATTTGCAACAAAACACAGATATGATGCCTACATGGGTGGAAATCTCAAGTTATTGTTTGGAATGGATCTCTCAGAAAATGAGCTGAGTGGTGAGATACCAGTAGAGTTTGGAGGTCTTTTGGAACTACGAGCTCTAAATCTATCTCACAACAACTTATCAGGTGTGATACCAAAAAGCATTTCAAGTATGGAGAAAATGGAAAGCTTTGATCTTTCTTTCAACAGATTACAAGGCCGGATCCCATCACAACTAACAGAGCTGACCAGCCTCTCTGTATTCAAAGTCTCACACAACAACTTATCAGGAGTCATTCCACAGGGAAGACAGTTTAACACCTTTGATGCAGAAAGCTACTTTGGTAATCGTCTCCTCTGTGGACAACCAACCAACAGAAGCTGCAACAATAATAGCTATGAAGAAGCAGATAATGGAGTGGAAGCTGATGAATCCATAATCGACATGGTATCTTTCTACTTGAGTTTTGCTGCTGCTTATGTGACAATACTTATTGGAATATTGGCATCTCTATCTTTTGATTCTCCTTGGAGCAGATTTTGGTTCTACAAGGTTGATGCTTTCATCAAAAAGGTGAGGAATTTATTGTTGTAA


Protein sequences

Name Description Sequence
disease resistance protein, putative; 1096-4664 disease resistance protein, putative; 1096-4664 [Arabidopsis thaliana].

MEGKVFLGHNLIWVMLLMGQLHGYKSCIDEEKIALFELRKHMISRTESESVLPTWTNDTTSDCCRWKGVACNRVSGRVTEISFGGLSLKDNSLLNLSLLHPFEDVRSLNLSSSRCSGLFDDVEGYKSLRKLRKLEILDLASNKFNNSIFHFLSAATSLTTLFLRSNNMDGSFPAKELRDLTNLELLDLSRNRFNGSIPIQELSSLRKLKALDLSGNEFSGSMELQGKFCTDLLFSIQSGICELNNMQELDLSQNKLVGHLPSCLTSLTGLRVLDLSSNKLTGTVPSSLGSLQSLEYLSLFDNDFEGSFSFGSLANLSNLMVLKLCSKSSSLQVLSESSWKPKFQLSVIALRSCNMEKVPHFLLHQKDLRHVDLSDNNISGKLPSWLLANNTKLKVLLLQNNLFTSFQIPKSAHNLLFLDVSANDFNHLFPENIGWIFPHLRYLNTSKNNFQENLPSSLGNMNGIQYMDLSRNSFHGNLPRSFVNGCYSMAILKLSHNKLSGEIFPESTNFTNILGLFMDNNLFTGKIGQGLRSLINLELLDMSNNNLTGVIPSWIGELPSLTALLISDNFLKGDIPMSLFNKSSLQLLDLSANSLSGVIPPQHDSRNGVVLLLQDNKLSGTIPDTLLANVEILDLRNNRFSGKIPEFINIQNISILLLRGNNFTGQIPHQLCGLSNIQLLDLSNNRLNGTIPSCLSNTSFGFGKECTSYDYDFGISFPSDVFNGFSLHQDFSSNKNGGIYFKSLLTLDPLSMDYKAATQTKIEFATKHRYDAYMGGNLKLLFGMDLSENELSGEIPVEFGGLLELRALNLSHNNLSGVIPKSISSMEKMESFDLSFNRLQGRIPSQLTELTSLSVFKVSHNNLSGVIPQGRQFNTFDAESYFGNRLLCGQPTNRSCNNNSYEEADNGVEADESIIDMVSFYLSFAAAYVTILIGILASLSFDSPWSRFWFYKVDAFIKKVRNLLL


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF473
1-949 PTHR24420:SF473,SUBFAMILY NOT NAMED

MEGKVFLGHNLIWVMLLMGQLHGYKSCIDEEKIALFELRKHMISRTESESVLPTWTNDTTSDCCRWKGVACNRVSGRVTEISFGGLSLKDNSLLNLSLLHPFEDVRSLNLSSSRCSGLFDDVEGYKSLRKLRKLEILDLASNKFNNSIFHFLSAATSLTTLFLRSNNMDGSFPAKELRDLTNLELLDLSRNRFNGSIPIQELSSLRKLKALDLSGNEFSGSMELQGKFCTDLLFSIQSGICELNNMQELDLSQNKLVGHLPSCLTSLTGLRVLDLSSNKLTGTVPSSLGSLQSLEYLSLFDNDFEGSFSFGSLANLSNLMVLKLCSKSSSLQVLSESSWKPKFQLSVIALRSCNMEKVPHFLLHQKDLRHVDLSDNNISGKLPSWLLANNTKLKVLLLQNNLFTSFQIPKSAHNLLFLDVSANDFNHLFPENIGWIFPHLRYLNTSKNNFQENLPSSLGNMNGIQYMDLSRNSFHGNLPRSFVNGCYSMAILKLSHNKLSGEIFPESTNFTNILGLFMDNNLFTGKIGQGLRSLINLELLDMSNNNLTGVIPSWIGELPSLTALLISDNFLKGDIPMSLFNKSSLQLLDLSANSLSGVIPPQHDSRNGVVLLLQDNKLSGTIPDTLLANVEILDLRNNRFSGKIPEFINIQNISILLLRGNNFTGQIPHQLCGLSNIQLLDLSNNRLNGTIPSCLSNTSFGFGKECTSYDYDFGISFPSDVFNGFSLHQDFSSNKNGGIYFKSLLTLDPLSMDYKAATQTKIEFATKHRYDAYMGGNLKLLFGMDLSENELSGEIPVEFGGLLELRALNLSHNNLSGVIPKSISSMEKMESFDLSFNRLQGRIPSQLTELTSLSVFKVSHNNLSGVIPQGRQFNTFDAESYFGNRLLCGQPTNRSCNNNSYEEADNGVEADESIIDMVSFYLSFAAAYVTILIGILASLSFDSPWSRFW

HMMPanther: PTHR24420
1-949 PTHR24420,FAMILY NOT NAMED

MEGKVFLGHNLIWVMLLMGQLHGYKSCIDEEKIALFELRKHMISRTESESVLPTWTNDTTSDCCRWKGVACNRVSGRVTEISFGGLSLKDNSLLNLSLLHPFEDVRSLNLSSSRCSGLFDDVEGYKSLRKLRKLEILDLASNKFNNSIFHFLSAATSLTTLFLRSNNMDGSFPAKELRDLTNLELLDLSRNRFNGSIPIQELSSLRKLKALDLSGNEFSGSMELQGKFCTDLLFSIQSGICELNNMQELDLSQNKLVGHLPSCLTSLTGLRVLDLSSNKLTGTVPSSLGSLQSLEYLSLFDNDFEGSFSFGSLANLSNLMVLKLCSKSSSLQVLSESSWKPKFQLSVIALRSCNMEKVPHFLLHQKDLRHVDLSDNNISGKLPSWLLANNTKLKVLLLQNNLFTSFQIPKSAHNLLFLDVSANDFNHLFPENIGWIFPHLRYLNTSKNNFQENLPSSLGNMNGIQYMDLSRNSFHGNLPRSFVNGCYSMAILKLSHNKLSGEIFPESTNFTNILGLFMDNNLFTGKIGQGLRSLINLELLDMSNNNLTGVIPSWIGELPSLTALLISDNFLKGDIPMSLFNKSSLQLLDLSANSLSGVIPPQHDSRNGVVLLLQDNKLSGTIPDTLLANVEILDLRNNRFSGKIPEFINIQNISILLLRGNNFTGQIPHQLCGLSNIQLLDLSNNRLNGTIPSCLSNTSFGFGKECTSYDYDFGISFPSDVFNGFSLHQDFSSNKNGGIYFKSLLTLDPLSMDYKAATQTKIEFATKHRYDAYMGGNLKLLFGMDLSENELSGEIPVEFGGLLELRALNLSHNNLSGVIPKSISSMEKMESFDLSFNRLQGRIPSQLTELTSLSVFKVSHNNLSGVIPQGRQFNTFDAESYFGNRLLCGQPTNRSCNNNSYEEADNGVEADESIIDMVSFYLSFAAAYVTILIGILASLSFDSPWSRFW

Gene3D: G3DSA:3.80.10.10
29-330 G3DSA:3.80.10.10

DEEKIALFELRKHMISRTESESVLPTWTNDTTSDCCRWKGVACNRVSGRVTEISFGGLSLKDNSLLNLSLLHPFEDVRSLNLSSSRCSGLFDDVEGYKSLRKLRKLEILDLASNKFNNSIFHFLSAATSLTTLFLRSNNMDGSFPAKELRDLTNLELLDLSRNRFNGSIPIQELSSLRKLKALDLSGNEFSGSMELQGKFCTDLLFSIQSGICELNNMQELDLSQNKLVGHLPSCLTSLTGLRVLDLSSNKLTGTVPSSLGSLQSLEYLSLFDNDFEGSFSFGSLANLSNLMVLKLCSKSSS

HMMPfam: PF08263
IPR013210
29-72 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

DEEKIALFELRKHMISRTESESVLPTWTNDTTSDCCRWKGVACN

superfamily: SSF52047
107-451 SSF52047,LRR

SLNLSSSRCSGLFDDVEGYKSLRKLRKLEILDLASNKFNNSIFHFLSAATSLTTLFLRSNNMDGSFPAKELRDLTNLELLDLSRNRFNGSIPIQELSSLRKLKALDLSGNEFSGSMELQGKFCTDLLFSIQSGICELNNMQELDLSQNKLVGHLPSCLTSLTGLRVLDLSSNKLTGTVPSSLGSLQSLEYLSLFDNDFEGSFSFGSLANLSNLMVLKLCSKSSSLQVLSESSWKPKFQLSVIALRSCNMEKVPHFLLHQKDLRHVDLSDNNISGKLPSWLLANNTKLKVLLLQNNLFTSFQIPKSAHNLLFLDVSANDFNHLFPENIGWIFPHLRYLNTSKNNFQ

HMMPfam: PF13855
156-217 LRR_8,Leucine rich repeat

TSLTTLFLRSNNMDGSFPAKELRDLTNLELLDLSRNRFNGSIPIQELSSLRKLKALDLSGNE

HMMPfam: PF13855
245-303 LRR_8,Leucine rich repeat

NMQELDLSQNKLVGHLPSCLTSLTGLRVLDLSSNKLTGTVPSSLGSLQSLEYLSLFDND

FPrintScan: PR00019
270-283 LEURICHRPT,Leucine-rich repeat signature

LRVLDLSSNKLTGT

Gene3D: G3DSA:3.80.10.10
331-498 G3DSA:3.80.10.10

LQVLSESSWKPKFQLSVIALRSCNMEKVPHFLLHQKDLRHVDLSDNNISGKLPSWLLANNTKLKVLLLQNNLFTSFQIPKSAHNLLFLDVSANDFNHLFPENIGWIFPHLRYLNTSKNNFQENLPSSLGNMNGIQYMDLSRNSFHGNLPRSFVNGCYSMAILKLSHNK

HMMPfam: PF00560
IPR001611
368-389 LRR_1
Leucine-rich repeat

LRHVDLSDNNISGKLPSWLLAN

superfamily: SSF52047
453-912 SSF52047,LRR

NLPSSLGNMNGIQYMDLSRNSFHGNLPRSFVNGCYSMAILKLSHNKLSGEIFPESTNFTNILGLFMDNNLFTGKIGQGLRSLINLELLDMSNNNLTGVIPSWIGELPSLTALLISDNFLKGDIPMSLFNKSSLQLLDLSANSLSGVIPPQHDSRNGVVLLLQDNKLSGTIPDTLLANVEILDLRNNRFSGKIPEFINIQNISILLLRGNNFTGQIPHQLCGLSNIQLLDLSNNRLNGTIPSCLSNTSFGFGKECTSYDYDFGISFPSDVFNGFSLHQDFSSNKNGGIYFKSLLTLDPLSMDYKAATQTKIEFATKHRYDAYMGGNLKLLFGMDLSENELSGEIPVEFGGLLELRALNLSHNNLSGVIPKSISSMEKMESFDLSFNRLQGRIPSQLTELTSLSVFKVSHNNLSGVIPQGRQFNTFDAESYFGNRLLCGQPTNRSCNNNSYEEADNGVEADE

Gene3D: G3DSA:3.80.10.10
499-617 G3DSA:3.80.10.10

LSGEIFPESTNFTNILGLFMDNNLFTGKIGQGLRSLINLELLDMSNNNLTGVIPSWIGELPSLTALLISDNFLKGDIPMSLFNKSSLQLLDLSANSLSGVIPPQHDSRNGVVLLLQDNK

HMMPfam: PF13855
536-595 LRR_8,Leucine rich repeat

NLELLDMSNNNLTGVIPSWIGELPSLTALLISDNFLKGDIPMSLFNKSSLQLLDLSANSL

Gene3D: G3DSA:3.80.10.10
618-702 G3DSA:3.80.10.10

LSGTIPDTLLANVEILDLRNNRFSGKIPEFINIQNISILLLRGNNFTGQIPHQLCGLSNIQLLDLSNNRLNGTIPSCLSNTSFGF

HMMPfam: PF00560
IPR001611
629-647 LRR_1
Leucine-rich repeat

NVEILDLRNNRFSGKIPEF

FPrintScan: PR00019
674-687 LEURICHRPT,Leucine-rich repeat signature

LSNIQLLDLSNNRL

HMMPfam: PF00560
IPR001611
676-696 LRR_1
Leucine-rich repeat

NIQLLDLSNNRLNGTIPSCLS

Gene3D: G3DSA:3.80.10.10
784-891 G3DSA:3.80.10.10

MDLSENELSGEIPVEFGGLLELRALNLSHNNLSGVIPKSISSMEKMESFDLSFNRLQGRIPSQLTELTSLSVFKVSHNNLSGVIPQGRQFNTFDAESYFGNRLLCGQP

HMMPfam: PF13855
805-863 LRR_8,Leucine rich repeat

LRALNLSHNNLSGVIPKSISSMEKMESFDLSFNRLQGRIPSQLTELTSLSVFKVSHNNL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox