PRGDB00049085 (F26A9.27)

From PRG Wiki
Jump to: navigation, search
F26A9.27
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 12323715 (AC016163)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana chromosome 1 BAC F26A9 genomic sequence, complete sequence.

DNA Sequence

ATGATCCGAAGCCATCGTCATTGGGTTTTTTCTAGTCGTATTATCATCTTTCTCTCCCTCCTTGTTCACTCTCTAGCTTCTTCTTCGCCCCACTTTTGCCGTGATGACCAGAGAGATGCTCTTTTGGAATTCAGAGGCGAGTTTCCGATAAATGCGTCATGGCATATTATGAATCAATGGAGAGGTCCGTGGAATAAGAGCACTGATTGTTGTCTTTGGAATGGAGTCACTTGCAATGATAAATCTGGTCAGGTAATATCACTCGACATTCCTAACACCTTTCTCAACAACTATTTGAAAACCAACAGTAGCCTTTTTAAACTCCAATATCTTCGTCACCTAGACCTTACGAATTGCAATCTCTACGGAGAGATTCCTTCTTCACTAGGAAACCTTTCTCATCTCACACTTGTTAACCTTTACTTTAATAAGTTTGTTGGAGAAATTCCGGCTTCAATCGGCAATCTAAACCAGCTTAGACACCTTATCCTTGCTAATAACGTCCTTACAGGAGAGATTCCTTCTTCACTAGGAAACCTTTCTCGTCTCGTAAACCTTGAGCTTTTTTCTAATAGATTGGTTGGTAAGATTCCAGATTCAATAGGAGATCTAAAGCAGCTAAGAAACCTTAGCCTTGCGTCTAACAATCTCATAGGCGAGATTCCTTCTTCCTTAGGAAACCTTTCTAATCTCGTACATCTTGTTCTTACGCATAATCAATTGGTAGGTGAAGTTCCTGCCTCCATAGGAAATCTAATCGAACTAAGAGTTATGTCATTTGAAAACAATAGCTTAAGTGGCAACATTCCTATTTCCTTCGCCAATTTAACAAAGCTTTCTATATTTGTCCTCAGCTCTAATAACTTCACATCCACGTTTCCATTTGACATGAGTATATTCCACAACTTGGAGTACTTTGATGTTTCTTATAACTCATTTAGCGGGCCTTTTCCTAAATCTCTGTTATTGATTCCTTCCTTAGAATCTATTTATCTGCAAGAAAACCAATTTACGGGACCTATAGAGTTTGCAAATACATCTTCATCAACTAAGCTTCAGGACCTAATCCTTGGTCGTAACAGACTCCATGGCCCAATCCCGGAATCTATATCTAGACTTCTCAACCTTGAAGAGCTAGATATCAGCCACAACAACTTTACTGGGGCAATCCCTCCAACTATATCAAAGCTAGTCAACCTCCTTCATCTTGATCTTTCCAAGAACAATTTGGAAGGTGAAGTACCAGCTTGCTTATGGAGATTGAATACAATGGTGCTTTCTCACAATTCTTTCAGCAGTTTTGAAAACACTTCACAAGAGGAAGCACTGATCGAAGAGTTGGATTTGAATTCAAATTCATTCCAAGGACCAATTCCTTATATGATCTGCAAGCTTAGTTCGTTAGGCTTTCTAGATTTGTCCAACAATCTCTTCAGCGGCTCGATTCCTTCATGTATAAGGAACTTCAGTGGTTCTATTAAAGAGCTAAATTTGGGGGACAACAACTTCAGTGGAACTCTTCCAGATATATTTTCCAAAGCTACCGAGTTGGTATCATTAGACGTTAGTCACAACCAGCTGGAGGGAAAGTTTCCAAAGTCTTTGATCAATTGCAAAGCTTTGGAACTTGTGAATGTGGAAAGCAACAAAATCAAGGATATATTTCCATCATGGTTGGAATCTCTACCGTCATTACATGTTCTCAACCTCAGATCAAACAAGTTCTATGGGCCGTTGTATCATCGACATGCATCTATTGGGTTTCAGAGTTTAAGGATCATCGATATATCACACAATAACTTCAGTGGAACTCTCCCACCTTACTATTTTTCCAACTGGAAAGACATGACCACATTAACAGAAGAAATGGACCAGTACATGACAGAGTTTTGGAGATATGCTGATAGCTATTACCATGAGATGGAAATGGTGAATAAAGGAGTTGATATGAGCTTTGAGCGGATCCGAAGAGACTTCAGAGCCATTGATTTTTCTGGAAACAAAATCAATGGTAATATCCCTGAATCCCTTGGCTATTTGAAAGAACTGCGGGTTCTCAACTTGTCAGGTAACGCATTCACAAGCGTCATCCCACGATTCTTGGCGAATTTGACAAAGCTGGAGACATTAGACATATCCCGTAATAAGCTGTCAGGTCAAATCCCTCAAGATCTTGCTGCACTCTCTTTTCTGTCATACATGAACTTCTCCCATAACCTTCTCCAAGGTCCAGTGCCACGAGGCACACAGTTTCAAAGGCAGAAATGTTCTTCATTCTTGGACAACCCTGGACTCTACGGTCTCGAAGATATTTGTAGGGATACTGGTGCCTTGAATCCTACATCGCAGCTACCCGAGGACTTGTCAGAGGCTGAGGAAAACATGTTCAACTGGGTAGCAGCTGCAATAGCCTATGGACCTGGCGTGTTATGTGGATTGGTGATCGGACATTTCTACACTTCACACAATCATGAGTGGTTCACAGAAAAGTTTGGTAGAAAACAACACAAAGCCCTTACAAGTGTGAAGTGTTCTCTTTAA


Protein sequences

Name Description Sequence
putative disease resistance protein; 66165-63625 putative disease resistance protein; 66165-63625 [Arabidopsis thaliana].

MIRSHRHWVFSSRIIIFLSLLVHSLASSSPHFCRDDQRDALLEFRGEFPINASWHIMNQWRGPWNKSTDCCLWNGVTCNDKSGQVISLDIPNTFLNNYLKTNSSLFKLQYLRHLDLTNCNLYGEIPSSLGNLSHLTLVNLYFNKFVGEIPASIGNLNQLRHLILANNVLTGEIPSSLGNLSRLVNLELFSNRLVGKIPDSIGDLKQLRNLSLASNNLIGEIPSSLGNLSNLVHLVLTHNQLVGEVPASIGNLIELRVMSFENNSLSGNIPISFANLTKLSIFVLSSNNFTSTFPFDMSIFHNLEYFDVSYNSFSGPFPKSLLLIPSLESIYLQENQFTGPIEFANTSSSTKLQDLILGRNRLHGPIPESISRLLNLEELDISHNNFTGAIPPTISKLVNLLHLDLSKNNLEGEVPACLWRLNTMVLSHNSFSSFENTSQEEALIEELDLNSNSFQGPIPYMICKLSSLGFLDLSNNLFSGSIPSCIRNFSGSIKELNLGDNNFSGTLPDIFSKATELVSLDVSHNQLEGKFPKSLINCKALELVNVESNKIKDIFPSWLESLPSLHVLNLRSNKFYGPLYHRHASIGFQSLRIIDISHNNFSGTLPPYYFSNWKDMTTLTEEMDQYMTEFWRYADSYYHEMEMVNKGVDMSFERIRRDFRAIDFSGNKINGNIPESLGYLKELRVLNLSGNAFTSVIPRFLANLTKLETLDISRNKLSGQIPQDLAALSFLSYMNFSHNLLQGPVPRGTQFQRQKCSSFLDNPGLYGLEDICRDTGALNPTSQLPEDLSEAEENMFNWVAAAIAYGPGVLCGLVIGHFYTSHNHEWFTEKFGRKQHKALTSVKCSL


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-833 FAMILY NOT NAMED,FAMILY NOT NAMED

MIRSHRHWVFSSRIIIFLSLLVHSLASSSPHFCRDDQRDALLEFRGEFPINASWHIMNQWRGPWNKSTDCCLWNGVTCNDKSGQVISLDIPNTFLNNYLKTNSSLFKLQYLRHLDLTNCNLYGEIPSSLGNLSHLTLVNLYFNKFVGEIPASIGNLNQLRHLILANNVLTGEIPSSLGNLSRLVNLELFSNRLVGKIPDSIGDLKQLRNLSLASNNLIGEIPSSLGNLSNLVHLVLTHNQLVGEVPASIGNLIELRVMSFENNSLSGNIPISFANLTKLSIFVLSSNNFTSTFPFDMSIFHNLEYFDVSYNSFSGPFPKSLLLIPSLESIYLQENQFTGPIEFANTSSSTKLQDLILGRNRLHGPIPESISRLLNLEELDISHNNFTGAIPPTISKLVNLLHLDLSKNNLEGEVPACLWRLNTMVLSHNSFSSFENTSQEEALIEELDLNSNSFQGPIPYMICKLSSLGFLDLSNNLFSGSIPSCIRNFSGSIKELNLGDNNFSGTLPDIFSKATELVSLDVSHNQLEGKFPKSLINCKALELVNVESNKIKDIFPSWLESLPSLHVLNLRSNKFYGPLYHRHASIGFQSLRIIDISHNNFSGTLPPYYFSNWKDMTTLTEEMDQYMTEFWRYADSYYHEMEMVNKGVDMSFERIRRDFRAIDFSGNKINGNIPESLGYLKELRVLNLSGNAFTSVIPRFLANLTKLETLDISRNKLSGQIPQDLAALSFLSYMNFSHNLLQGPVPRGTQFQRQKCSSFLDNPGLYGLEDICRDTGALNPTSQLPEDLSEAEENMFNWVAAAIAYGPGVLCGLVIGHFYTSHNHEWFTEKFGR

HMMPanther: PTHR24420:SF911
1-833 DISEASE RESISTANCE FAMILY PROTEIN

MIRSHRHWVFSSRIIIFLSLLVHSLASSSPHFCRDDQRDALLEFRGEFPINASWHIMNQWRGPWNKSTDCCLWNGVTCNDKSGQVISLDIPNTFLNNYLKTNSSLFKLQYLRHLDLTNCNLYGEIPSSLGNLSHLTLVNLYFNKFVGEIPASIGNLNQLRHLILANNVLTGEIPSSLGNLSRLVNLELFSNRLVGKIPDSIGDLKQLRNLSLASNNLIGEIPSSLGNLSNLVHLVLTHNQLVGEVPASIGNLIELRVMSFENNSLSGNIPISFANLTKLSIFVLSSNNFTSTFPFDMSIFHNLEYFDVSYNSFSGPFPKSLLLIPSLESIYLQENQFTGPIEFANTSSSTKLQDLILGRNRLHGPIPESISRLLNLEELDISHNNFTGAIPPTISKLVNLLHLDLSKNNLEGEVPACLWRLNTMVLSHNSFSSFENTSQEEALIEELDLNSNSFQGPIPYMICKLSSLGFLDLSNNLFSGSIPSCIRNFSGSIKELNLGDNNFSGTLPDIFSKATELVSLDVSHNQLEGKFPKSLINCKALELVNVESNKIKDIFPSWLESLPSLHVLNLRSNKFYGPLYHRHASIGFQSLRIIDISHNNFSGTLPPYYFSNWKDMTTLTEEMDQYMTEFWRYADSYYHEMEMVNKGVDMSFERIRRDFRAIDFSGNKINGNIPESLGYLKELRVLNLSGNAFTSVIPRFLANLTKLETLDISRNKLSGQIPQDLAALSFLSYMNFSHNLLQGPVPRGTQFQRQKCSSFLDNPGLYGLEDICRDTGALNPTSQLPEDLSEAEENMFNWVAAAIAYGPGVLCGLVIGHFYTSHNHEWFTEKFGR

Seg: seg
18-29 seg

LSLLVHSLASSS

superfamily: SSF52058
31-347 L domain-like,LRR

HFCRDDQRDALLEFRGEFPINASWHIMNQWRGPWNKSTDCCLWNGVTCNDKSGQVISLDIPNTFLNNYLKTNSSLFKLQYLRHLDLTNCNLYGEIPSSLGNLSHLTLVNLYFNKFVGEIPASIGNLNQLRHLILANNVLTGEIPSSLGNLSRLVNLELFSNRLVGKIPDSIGDLKQLRNLSLASNNLIGEIPSSLGNLSNLVHLVLTHNQLVGEVPASIGNLIELRVMSFENNSLSGNIPISFANLTKLSIFVLSSNNFTSTFPFDMSIFHNLEYFDVSYNSFSGPFPKSLLLIPSLESIYLQENQFTGPIEFANTS

Gene3D: G3DSA:3.80.10.10
33-342 no description

CRDDQRDALLEFRGEFPINASWHIMNQWRGPWNKSTDCCLWNGVTCNDKSGQVISLDIPNTFLNNYLKTNSSLFKLQYLRHLDLTNCNLYGEIPSSLGNLSHLTLVNLYFNKFVGEIPASIGNLNQLRHLILANNVLTGEIPSSLGNLSRLVNLELFSNRLVGKIPDSIGDLKQLRNLSLASNNLIGEIPSSLGNLSNLVHLVLTHNQLVGEVPASIGNLIELRVMSFENNSLSGNIPISFANLTKLSIFVLSSNNFTSTFPFDMSIFHNLEYFDVSYNSFSGPFPKSLLLIPSLESIYLQENQFTGPIE

HMMPfam: PF08263
IPR013210
35-79 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

DDQRDALLEFRGEFPINASWHIMNQWRGPWNKSTDCCLWNGVTCN

HMMSmart: SM00369
IPR003591
108-132 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LQYLRHLDLTNCNLYGEIPSSLGNL

HMMPfam: PF00560
IPR001611
111-132 LRR_1
Leucine-rich repeat

LRHLDLTNCNLYGEIPSSLGNL

HMMSmart: SM00369
IPR003591
156-180 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LNQLRHLILANNVLTGEIPSSLGNL

HMMPfam: PF00560
IPR001611
158-180 LRR_1
Leucine-rich repeat

QLRHLILANNVLTGEIPSSLGNL

HMMSmart: SM00365
204-230 Leucine-rich repeat, SDS22-like subfamily

LKQLRNLSLASNNLIGEIPSSLGNLSN

HMMSmart: SM00369
IPR003591
204-227 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKQLRNLSLASNNLIGEIPSSLGN

HMMPfam: PF00560
IPR001611
206-228 LRR_1
Leucine-rich repeat

QLRNLSLASNNLIGEIPSSLGNL

HMMSmart: SM00369
IPR003591
228-252 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSNLVHLVLTHNQLVGEVPASIGNL

superfamily: SSF52047
301-649 RNI-like,LRR

HNLEYFDVSYNSFSGPFPKSLLLIPSLESIYLQENQFTGPIEFANTSSSTKLQDLILGRNRLHGPIPESISRLLNLEELDISHNNFTGAIPPTISKLVNLLHLDLSKNNLEGEVPACLWRLNTMVLSHNSFSSFENTSQEEALIEELDLNSNSFQGPIPYMICKLSSLGFLDLSNNLFSGSIPSCIRNFSGSIKELNLGDNNFSGTLPDIFSKATELVSLDVSHNQLEGKFPKSLINCKALELVNVESNKIKDIFPSWLESLPSLHVLNLRSNKFYGPLYHRHASIGFQSLRIIDISHNNFSGTLPPYYFSNWKDMTTLTEEMDQYMTEFWRYADSYYHEMEMVNKGVD

Gene3D: G3DSA:3.80.10.10
349-489 no description

STKLQDLILGRNRLHGPIPESISRLLNLEELDISHNNFTGAIPPTISKLVNLLHLDLSKNNLEGEVPACLWRLNTMVLSHNSFSSFENTSQEEALIEELDLNSNSFQGPIPYMICKLSSLGFLDLSNNLFSGSIPSCIRNF

HMMPfam: PF13855
351-410 LRR_8,Leucine rich repeat

KLQDLILGRNRLHGPIPESISRLLNLEELDISHNNFTGAIPPTISKLVNLLHLDLSKNNL

HMMSmart: SM00365
373-402 Leucine-rich repeat, SDS22-like subfamily

LLNLEELDISHNNFTGAIPPTISKLVNLLH

HMMSmart: SM00369
IPR003591
373-396 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LLNLEELDISHNNFTGAIPPTISK

HMMSmart: SM00369
IPR003591
397-421 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LVNLLHLDLSKNNLEGEVPACLWRL

FPrintScan: PR00019
400-413 LEURICHRPT,Leucine-rich repeat signature

LLHLDLSKNNLEGE

HMMSmart: SM00365
465-491 Leucine-rich repeat, SDS22-like subfamily

LSSLGFLDLSNNLFSGSIPSCIRNFSG

HMMSmart: SM00369
IPR003591
465-488 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LSSLGFLDLSNNLFSGSIPSCIRN

HMMPfam: PF00560
IPR001611
492-512 LRR_1
Leucine-rich repeat

SIKELNLGDNNFSGTLPDIFS

HMMSmart: SM00365
514-540 Leucine-rich repeat, SDS22-like subfamily

ATELVSLDVSHNQLEGKFPKSLINCKA

HMMPfam: PF13855
516-574 LRR_8,Leucine rich repeat

ELVSLDVSHNQLEGKFPKSLINCKALELVNVESNKIKDIFPSWLESLPSLHVLNLRSNK

HMMSmart: SM00369
IPR003591
588-612 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

FQSLRIIDISHNNFSGTLPPYYFSN

HMMPfam: PF00560
IPR001611
590-612 LRR_1
Leucine-rich repeat

SLRIIDISHNNFSGTLPPYYFSN

superfamily: SSF52058
660-784 L domain-like,LRR

RAIDFSGNKINGNIPESLGYLKELRVLNLSGNAFTSVIPRFLANLTKLETLDISRNKLSGQIPQDLAALSFLSYMNFSHNLLQGPVPRGTQFQRQKCSSFLDNPGLYGLEDICRDTGALNPTSQL

Gene3D: G3DSA:3.80.10.10
661-767 no description

AIDFSGNKINGNIPESLGYLKELRVLNLSGNAFTSVIPRFLANLTKLETLDISRNKLSGQIPQDLAALSFLSYMNFSHNLLQGPVPRGTQFQRQKCSSFLDNPGLYG

HMMSmart: SM00369
IPR003591
680-703 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LKELRVLNLSGNAFTSVIPRFLAN

HMMPfam: PF13855
682-741 LRR_8,Leucine rich repeat

ELRVLNLSGNAFTSVIPRFLANLTKLETLDISRNKLSGQIPQDLAALSFLSYMNFSHNLL

FPrintScan: PR00019
704-717 LEURICHRPT,Leucine-rich repeat signature

LTKLETLDISRNKL

HMMSmart: SM00365
704-727 Leucine-rich repeat, SDS22-like subfamily

LTKLETLDISRNKLSGQIPQDLAA

HMMSmart: SM00369
IPR003591
704-728 Leucine-rich repeats, typical (most populate
Leucine-rich repeat, typical subtype

LTKLETLDISRNKLSGQIPQDLAAL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox