PRGDB00049086 (F26A9.27)

From PRG Wiki
Jump to: navigation, search
F26A9.27
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 12323715 (AC016163)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana chromosome 1 BAC F26A9 genomic sequence, complete sequence.

DNA Sequence

ATGACTCGAAGCCATTGTTATTGGTTTTATTGTATTATTACCATATATTTCTCCTTCCTTATACACTCTCTAGCTTCTCCTTCGCTTCACTTTTGCCGCCACGACCAGAGGGATGGTCTTTTGAAATTCAGAGACGAGTTTCCGATCTTTGAGTCTAAATCAAGTCCGTGGAATAAGACCACCGATTGCTGTTCTTGGGACGGTGTCACGTGCGATGATAAATCTGGCCAGGTAATATCACTCGACCTTCGTAGCACCCTTCTCAACAGCTCTTTGAAAACCAACAGTAGTCTTTTTAGACTCCAATATCTTCGTCACCTAGACCTTTCTGGTTGCAATCTCCATGGAGAGATTCCTTCTTCACTAGGAAACCTTTCCCGTCTCGAAAATCTTGAGCTTTCTTCTAATAGATTGGTCGGTGAGATTCCGTATTCAATAGGGAACCTAAAGCAACTAAGAAACCTTAGCCTTGGGGATAACGATCTCATAGGAGAAATTCCTTCTTCCCTAGGAAACCTTTCTCTTCTCTTAGATCTTGACCTTTGGAATAATTCTTTGGTAGGTGAAGTTCCAGCTTCCATCGGAAACCTAAACGAACTAAGAGTCATGTCACTTGACCGTAACAGCTTAAGTGGCAGTATACCTATTTCATTTACTAACTTAACCAAACTTTCCGAGTTTAGAATCTTCTTTAACAACTTCACATCCCTTCCTTCTGACCTGAGTGGCTTCCACAACTTGGTGACGTTTGATATTAGTGCAAACTCATTTTCCGGGCATTTCCCTAAATTTTTGTTCTCGATTCCTTCGTTAGCATGGGTTTCTATGGATAGAAACCAATTCTCAGGACCTATAGAGTTTGCTAATATATCTTCATCATCTAAGCTTCAGAATCTAATCCTCACTCGTAACAAATTAGATGGCTCAATCCCTGAATCCATATCTAAGTTTCTCAACCTCGTACTGTTAGATGTTGCCCACAATAATATCAGTGGACCAGTCCCTAGGTCTATGTCAAAGTTAGTTAGCCTCCGTATCTTTGGTTTTTCCAACAACAAGTTGGAAGGTGAAGTACCAAGTTGGTTGTGGAGATTGTCTTCAACAATGCTTTCTCACAATTCTTTCAGCAGTTTTGAAAAAATATATTCAAAAGAAACAATGATCCAAGTGTTGGATCTAAGTTTCAATTCCTTCCGAGGGACGTTTCCCGTTTGGATCTGCAAGCTGAAAGGGTTACACTTCTTAGATTTGTCCAACAATCTCTTCAACGGTTCGATTCCTTTATGTTTAAGGAACTTCAATCTTACGGGGCTAATTCTTGGAAACAACAAGTTCAGTGGAACTCTTCCGGACATATTTGCCAATAATACCAACTTACAATCATTGGACGTAAGTGGCAACCAGTTAGAGGGGAAGTTTCCAAAGTCTTTGATAAATTGCAAAGGTTTGCATTTTGTGAATGTTGAAAGCAACAAAATCAAGGATACGTTTCCATCTTGGTTGGGATCTCTACCATCTTTACAAGTTCTCATCCTAAGATCAAACGACTTCTATGGTCCGTTGTATCATCCCAGCATGTCCATTGGGTTTCAAGGTTTAAGAATCATCGATATATCACACAATGGCTTCTCTGGAGTACTCCCACCTAACTTTTTTTCTAGTTGGCGTGAAATGATTACATTAGTCCATGGAAGTTATGAATACATTGAAGATATTCAGAATTATTCTCTTATCTATCGCTCCATGGAAATGGTGAATAAAGGAGTAGAGATGAGTTTTGAGAGGATCCGACAAGACTTTAGAGCCATTGATTTTTCTGAAAACAGAATTTATGGCGAAATACCTGAATCCATTGGTTGTTTGGAGGAACTGCGTCTTCTCAACTTGTCAGGTAACGCTTTCACAAGCGATATCCCACGGGTCTGGGAAAATCTCACAAAGCTCGAGACGTTAGACCTATCACGTAACAAGTTGTCTGGTCAAATCCCACAAGATCTTGGTAAACTCTCCTTTCTGTCGTACATGAACTTCTCCCATAACCGTCTCCAAGGTCCAGTGCCACGAGGCACACAGTTTCAAAGGCAGAGATGTTCTTCATTTTTGGACAACCATAGACTCTACGGTCTCGAAGATATCTGTGAGGAGACTCATGTCCCGAATCCTACATCACAACCATCCGAGGATTTGTTAGACGAGGAGGAAAAAATGTTCAACTGGGTAGCAGCTGCAATAGCATATGGACCTGGTGTATTTTGTGGTCTGGTGATCGGATACATCTTCACTTCACACCATCATGAGTGGTTTACGGAAAAGTTTGGTCGGAAAAAAATCAGAGTAACCACAAGTGCTCGTTAA


Protein sequences

Name Description Sequence
putative disease resistance protein; 69620-67266 putative disease resistance protein; 69620-67266 [Arabidopsis thaliana].

MTRSHCYWFYCIITIYFSFLIHSLASPSLHFCRHDQRDGLLKFRDEFPIFESKSSPWNKTTDCCSWDGVTCDDKSGQVISLDLRSTLLNSSLKTNSSLFRLQYLRHLDLSGCNLHGEIPSSLGNLSRLENLELSSNRLVGEIPYSIGNLKQLRNLSLGDNDLIGEIPSSLGNLSLLLDLDLWNNSLVGEVPASIGNLNELRVMSLDRNSLSGSIPISFTNLTKLSEFRIFFNNFTSLPSDLSGFHNLVTFDISANSFSGHFPKFLFSIPSLAWVSMDRNQFSGPIEFANISSSSKLQNLILTRNKLDGSIPESISKFLNLVLLDVAHNNISGPVPRSMSKLVSLRIFGFSNNKLEGEVPSWLWRLSSTMLSHNSFSSFEKIYSKETMIQVLDLSFNSFRGTFPVWICKLKGLHFLDLSNNLFNGSIPLCLRNFNLTGLILGNNKFSGTLPDIFANNTNLQSLDVSGNQLEGKFPKSLINCKGLHFVNVESNKIKDTFPSWLGSLPSLQVLILRSNDFYGPLYHPSMSIGFQGLRIIDISHNGFSGVLPPNFFSSWREMITLVHGSYEYIEDIQNYSLIYRSMEMVNKGVEMSFERIRQDFRAIDFSENRIYGEIPESIGCLEELRLLNLSGNAFTSDIPRVWENLTKLETLDLSRNKLSGQIPQDLGKLSFLSYMNFSHNRLQGPVPRGTQFQRQRCSSFLDNHRLYGLEDICEETHVPNPTSQPSEDLLDEEEKMFNWVAAAIAYGPGVFCGLVIGYIFTSHHHEWFTEKFGRKKIRVTTSAR


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-774 PTHR24420,FAMILY NOT NAMED

MTRSHCYWFYCIITIYFSFLIHSLASPSLHFCRHDQRDGLLKFRDEFPIFESKSSPWNKTTDCCSWDGVTCDDKSGQVISLDLRSTLLNSSLKTNSSLFRLQYLRHLDLSGCNLHGEIPSSLGNLSRLENLELSSNRLVGEIPYSIGNLKQLRNLSLGDNDLIGEIPSSLGNLSLLLDLDLWNNSLVGEVPASIGNLNELRVMSLDRNSLSGSIPISFTNLTKLSEFRIFFNNFTSLPSDLSGFHNLVTFDISANSFSGHFPKFLFSIPSLAWVSMDRNQFSGPIEFANISSSSKLQNLILTRNKLDGSIPESISKFLNLVLLDVAHNNISGPVPRSMSKLVSLRIFGFSNNKLEGEVPSWLWRLSSTMLSHNSFSSFEKIYSKETMIQVLDLSFNSFRGTFPVWICKLKGLHFLDLSNNLFNGSIPLCLRNFNLTGLILGNNKFSGTLPDIFANNTNLQSLDVSGNQLEGKFPKSLINCKGLHFVNVESNKIKDTFPSWLGSLPSLQVLILRSNDFYGPLYHPSMSIGFQGLRIIDISHNGFSGVLPPNFFSSWREMITLVHGSYEYIEDIQNYSLIYRSMEMVNKGVEMSFERIRQDFRAIDFSENRIYGEIPESIGCLEELRLLNLSGNAFTSDIPRVWENLTKLETLDLSRNKLSGQIPQDLGKLSFLSYMNFSHNRLQGPVPRGTQFQRQRCSSFLDNHRLYGLEDICEETHVPNPTSQPSEDLLDEEEKMFNWVAAAIAYGPGVFCGLVIGYIFTSHHHEWFTEKFGR

HMMPanther: PTHR24420:SF911
1-774 PTHR24420:SF911

MTRSHCYWFYCIITIYFSFLIHSLASPSLHFCRHDQRDGLLKFRDEFPIFESKSSPWNKTTDCCSWDGVTCDDKSGQVISLDLRSTLLNSSLKTNSSLFRLQYLRHLDLSGCNLHGEIPSSLGNLSRLENLELSSNRLVGEIPYSIGNLKQLRNLSLGDNDLIGEIPSSLGNLSLLLDLDLWNNSLVGEVPASIGNLNELRVMSLDRNSLSGSIPISFTNLTKLSEFRIFFNNFTSLPSDLSGFHNLVTFDISANSFSGHFPKFLFSIPSLAWVSMDRNQFSGPIEFANISSSSKLQNLILTRNKLDGSIPESISKFLNLVLLDVAHNNISGPVPRSMSKLVSLRIFGFSNNKLEGEVPSWLWRLSSTMLSHNSFSSFEKIYSKETMIQVLDLSFNSFRGTFPVWICKLKGLHFLDLSNNLFNGSIPLCLRNFNLTGLILGNNKFSGTLPDIFANNTNLQSLDVSGNQLEGKFPKSLINCKGLHFVNVESNKIKDTFPSWLGSLPSLQVLILRSNDFYGPLYHPSMSIGFQGLRIIDISHNGFSGVLPPNFFSSWREMITLVHGSYEYIEDIQNYSLIYRSMEMVNKGVEMSFERIRQDFRAIDFSENRIYGEIPESIGCLEELRLLNLSGNAFTSDIPRVWENLTKLETLDLSRNKLSGQIPQDLGKLSFLSYMNFSHNRLQGPVPRGTQFQRQRCSSFLDNHRLYGLEDICEETHVPNPTSQPSEDLLDEEEKMFNWVAAAIAYGPGVFCGLVIGYIFTSHHHEWFTEKFGR

superfamily: SSF52058
30-286 SSF52058,LRR

HFCRHDQRDGLLKFRDEFPIFESKSSPWNKTTDCCSWDGVTCDDKSGQVISLDLRSTLLNSSLKTNSSLFRLQYLRHLDLSGCNLHGEIPSSLGNLSRLENLELSSNRLVGEIPYSIGNLKQLRNLSLGDNDLIGEIPSSLGNLSLLLDLDLWNNSLVGEVPASIGNLNELRVMSLDRNSLSGSIPISFTNLTKLSEFRIFFNNFTSLPSDLSGFHNLVTFDISANSFSGHFPKFLFSIPSLAWVSMDRNQFSGPIE

Gene3D: G3DSA:3.80.10.10
32-273 G3DSA:3.80.10.10

CRHDQRDGLLKFRDEFPIFESKSSPWNKTTDCCSWDGVTCDDKSGQVISLDLRSTLLNSSLKTNSSLFRLQYLRHLDLSGCNLHGEIPSSLGNLSRLENLELSSNRLVGEIPYSIGNLKQLRNLSLGDNDLIGEIPSSLGNLSLLLDLDLWNNSLVGEVPASIGNLNELRVMSLDRNSLSGSIPISFTNLTKLSEFRIFFNNFTSLPSDLSGFHNLVTFDISANSFSGHFPKFLFSIPSLAW

HMMPfam: PF08263
IPR013210
34-72 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

HDQRDGLLKFRDEFPIFESKSSPWNKTTDCCSWDGVTCD

HMMPfam: PF12799
103-138 LRR_4,Leucine Rich repeats (2 copies)

YLRHLDLSGCNLHGEIPSSLGNLSRLENLELSSNRL

superfamily: SSF52047
236-430 SSF52047,LRR

SLPSDLSGFHNLVTFDISANSFSGHFPKFLFSIPSLAWVSMDRNQFSGPIEFANISSSSKLQNLILTRNKLDGSIPESISKFLNLVLLDVAHNNISGPVPRSMSKLVSLRIFGFSNNKLEGEVPSWLWRLSSTMLSHNSFSSFEKIYSKETMIQVLDLSFNSFRGTFPVWICKLKGLHFLDLSNNLFNGSIPLCL

Gene3D: G3DSA:3.80.10.10
274-440 G3DSA:3.80.10.10

VSMDRNQFSGPIEFANISSSSKLQNLILTRNKLDGSIPESISKFLNLVLLDVAHNNISGPVPRSMSKLVSLRIFGFSNNKLEGEVPSWLWRLSSTMLSHNSFSSFEKIYSKETMIQVLDLSFNSFRGTFPVWICKLKGLHFLDLSNNLFNGSIPLCLRNFNLTGLIL

HMMPfam: PF13855
294-354 LRR_8,Leucine rich repeat

SKLQNLILTRNKLDGSIPESISKFLNLVLLDVAHNNISGPVPRSMSKLVSLRIFGFSNNKL

superfamily: SSF52058
434-710 SSF52058,LRR

NLTGLILGNNKFSGTLPDIFANNTNLQSLDVSGNQLEGKFPKSLINCKGLHFVNVESNKIKDTFPSWLGSLPSLQVLILRSNDFYGPLYHPSMSIGFQGLRIIDISHNGFSGVLPPNFFSSWREMITLVHGSYEYIEDIQNYSLIYRSMEMVNKGVEMSFERIRQDFRAIDFSENRIYGEIPESIGCLEELRLLNLSGNAFTSDIPRVWENLTKLETLDLSRNKLSGQIPQDLGKLSFLSYMNFSHNRLQGPVPRGTQFQRQRCSSFLDNHRLYGLE

Gene3D: G3DSA:3.80.10.10
441-563 G3DSA:3.80.10.10

GNNKFSGTLPDIFANNTNLQSLDVSGNQLEGKFPKSLINCKGLHFVNVESNKIKDTFPSWLGSLPSLQVLILRSNDFYGPLYHPSMSIGFQGLRIIDISHNGFSGVLPPNFFSSWREMITLVH

HMMPfam: PF13855
457-516 LRR_8,Leucine rich repeat

TNLQSLDVSGNQLEGKFPKSLINCKGLHFVNVESNKIKDTFPSWLGSLPSLQVLILRSND

FPrintScan: PR00019
459-472 LEURICHRPT,Leucine-rich repeat signature

LQSLDVSGNQLEGK

HMMPfam: PF00560
IPR001611
533-554 LRR_1
Leucine-rich repeat

LRIIDISHNGFSGVLPPNFFSS

Gene3D: G3DSA:3.80.10.10
603-704 G3DSA:3.80.10.10

IDFSENRIYGEIPESIGCLEELRLLNLSGNAFTSDIPRVWENLTKLETLDLSRNKLSGQIPQDLGKLSFLSYMNFSHNRLQGPVPRGTQFQRQRCSSFLDNH

HMMPfam: PF13855
623-682 LRR_8,Leucine rich repeat

ELRLLNLSGNAFTSDIPRVWENLTKLETLDLSRNKLSGQIPQDLGKLSFLSYMNFSHNRL

FPrintScan: PR00019
645-658 LEURICHRPT,Leucine-rich repeat signature

LTKLETLDLSRNKL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox