PRGDB00049087 (T6B12.4)

From PRG Wiki
Jump to: navigation, search
T6B12.4
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 12323624 (AC079679)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana chromosome 1 BAC T6B12 genomic sequence, complete sequence.

DNA Sequence

ATGGAACTTTATGTTTTCTTTATATATGTAGTCGGGAAGACACTTCATAAAAAGATCCAAAACACTAATTTACTATTATTATTCGGAAAACTTTGTTTTTTCACAAATATAAAAGTTTTCATATTTAGTGAGAAAATGAGCTTCCTTATTCGTTCCATCTGTTTCCTTATCCTCATTCCTAGTTTTCTAATCACGTTTGTTTCAGCTACGCAACACTTGTGTCATTCCGACCAAAAGGATGCTCTTCTTGATTTCAAGAATGAGTTTGGGATGGTTGATTCAAAATCATGGGTGAACAAAAGTGATTGTTGTTCGTGGGATGGTATCACGTGTGATGCTAAGTCGGGAAACGTGATCGGGCTAGACCTTAGTTCTATCTTCCTCTATGGCCAGCTCAAATCCAACAGTAGTCTTTTTAAACTGCGTCATCTCCGTGATCTAAACCTCGCTAACAACAATTTCAACAATTCGCCAATACCAGCTGAGTTTGATAAACTCACAGGGCTAGAAAGACTTGACCTCTCTCAGTCTTCACTTTCAGGCCAAATTCCAATCAATCTTCTTCAGCTAACAAAGTTGGTGTCTCTCGATCTTTCTTCTAGTGATTTTTTCGGTGATGAATCTTTTCATTATTTATCCATTGATAAATCTTTTCTTCCTCTACTTGCTCGAAACTTGAGGAACCTTAGAGAACTAGATATGAGCTACGTAAAAATTTCTTCAGAAATCCCCGAGGAGTTTTCAAACATACGGTCTCTAAGATCTCTAAATCTTAATGGCTGCAACCTATTTGGAGAATTTCCAAGCAGTATTCTTCTGATTCCCAACTTACAATCTATTGACTTAGGGAACAATCCTAATCTGAGAGGCAATCTTCCCGTTTTTCATGAAAACAACTCTTTGCTAAAGTTGACCATTTTGTACACATCCTTTTCAGGTGCCATACCTGACTCCATTAGTAGCCTAAAAAATTTGACCTCTTTGACCCTTTCCGTTTCTTATTTCTCTGGGAAGATTCCATTTTCACTTGGGAATCTTTCCCATCTCTCCCATCTTAGTCTCTCTTCTAATAATCTTATTGGTGAAATCCCATCTTCAATTGGCAATCTAAACCAATTGACCAATTTTTATGTTGGTGGTAACAAGCTTAGTGGAAACTTGCCAGCTACGCTAAGCAATTTGACCAAACTAAATACAATCTCTCTCTCTTCCAACCAGTTCACAGGTTCCCTTCCACCTAGCATTAGCCAACTCTCTAAACTGAAGTTCTTTTTTGCTGATGATAATCCTTTTATAGGAGCCATTCTTTCACCCCTACTCAAGATTCCCTCATTGACTAGGATCCATTTGAGTTATAACCAACTCAACGACCTTGTTGGGATTGAGAATATCTTTATGTTACCTAATTTAGAAACCTTTTATATTTACCATTACAATTACACCAAAGTCCGTCCACTTGACTTAAATGTCTTCTCGTCTCTCAAGCAGCTAGGCACATTATATATCTCACGCATCCCCATTTCAACCACAAACATCACTTCTGATTTTCCATCAAATTTGGAATATTTGAGCTTAAGAAGCTGCAACATCACTGACTTCCCTGAGTTCATAAGAAAGGGGAGAAATCTACAGATTCTAGATCTTTCCAACAACAAAATCAAAGGTCAAGTACCAGACTGGTTGTGGAGAATGCCAACGTTGAATAGTGTGGATCTTTCTAACAACTCGCTCAGCGGTTTCCATGTATCCGTAAAAGCATCTCCCGAGAGTCAACTCACGAGTGTAGACCTAAGCTCAAATGCTTTTCAAGGACCACTCTTCCTCCCGTCCAAGTCTCTCAGATATTTTTCTGGTTCCAACAATAACTTCACCGGAAAGATACCTCGATCAATATGTGGACTAAGCTCTCTAGAGATCCTAGATCTATCAAACAACAACCTCAACGGCTCACTCCCTTGGTGTTTAGAAACTCTTATGAGTTCTCTTTCAGATCTAGATCTCCGTAACAACAGCCTCAGCGGAAGTCTTCCTGAAATATTTATGAATGCCACGAAGTTAAGGTCACTTGACGTCAGCCACAACCGAATGGAGGGAAAGCTTCCTGGTTCTCTTACTGGTTGCTCTTCTCTGGAAGTTCTAAATGTGGGAAGCAATAGAATCAACGACATGTTTCCCTTCGAGTTGAATTCTTTACAGAAGCTTCAAGTTCTTGTCCTCCACTCTAACAAGTTTCATGGCACATTACATAACGTTGATGGGGTTTGGTTTGGATTTCCTCAGTTGCAAATCATTGATGTATCACATAATGACTTCTTCGGTATCTTGCCATCTGATTACTTCATGAACTGGACTGCGATGTCCTCCAAGAAAGATAATAATATAGAGCCAGAGTACATTCAGAATCCTAGTGTATACGGTTCCTCACTTGGCTACTACACTTCACTTGTCTTGATGAGTAAAGGAGTATCAATGGAGATGGAACGTGTCCTTACAATCTACACGGCCATCGATTTATCAGGGAATCAACTACATGGAAAGATTCCTGATTCTATTGGTCTGCTGAAGGAGCTTCGAATTCTGAACATGTCAAGCAATGGTTTTACAGGCCACATCCCATCTTCTTTAGCAAACCTGAAGAATCTTGAGTCACTCGACATATCCCAAAACAATATCTCTGGTGAGATTCCTCCTGAGCTCGGGACTCTCTCTTCTCTCGCGTGGATAAACGTTTCACATAACCAGCTTGTAGGTTCCATACCACAAGGCACACAATTTCAACGGCAAAAATGCTCTTCCTACGAAGGAAACCCCGGACTTAATGGTCCTTCTCTTGAGAATGTTTGTGGACATATCAAAGAGTCAACACCAACACAAACCGAACCGTTGGAGACAAAAGAAGAAGAAGAAGAAGAATCATTTAGTTGGATAGCAGCAGGTTTAGGCTTTGCACCTGGAGTTGTATTTGGACTAGCGATGGGATACATAGTGGTTTCATACAAGCATCAATGGTTCATGAAGACTTTCGGACGAAGCAAGCAACAGAACACCAGAACTCGTTAA


Protein sequences

Name Description Sequence
disease resistance protein, putative; 3954-7013 disease resistance protein, putative; 3954-7013 [Arabidopsis thaliana].

MELYVFFIYVVGKTLHKKIQNTNLLLLFGKLCFFTNIKVFIFSEKMSFLIRSICFLILIPSFLITFVSATQHLCHSDQKDALLDFKNEFGMVDSKSWVNKSDCCSWDGITCDAKSGNVIGLDLSSIFLYGQLKSNSSLFKLRHLRDLNLANNNFNNSPIPAEFDKLTGLERLDLSQSSLSGQIPINLLQLTKLVSLDLSSSDFFGDESFHYLSIDKSFLPLLARNLRNLRELDMSYVKISSEIPEEFSNIRSLRSLNLNGCNLFGEFPSSILLIPNLQSIDLGNNPNLRGNLPVFHENNSLLKLTILYTSFSGAIPDSISSLKNLTSLTLSVSYFSGKIPFSLGNLSHLSHLSLSSNNLIGEIPSSIGNLNQLTNFYVGGNKLSGNLPATLSNLTKLNTISLSSNQFTGSLPPSISQLSKLKFFFADDNPFIGAILSPLLKIPSLTRIHLSYNQLNDLVGIENIFMLPNLETFYIYHYNYTKVRPLDLNVFSSLKQLGTLYISRIPISTTNITSDFPSNLEYLSLRSCNITDFPEFIRKGRNLQILDLSNNKIKGQVPDWLWRMPTLNSVDLSNNSLSGFHVSVKASPESQLTSVDLSSNAFQGPLFLPSKSLRYFSGSNNNFTGKIPRSICGLSSLEILDLSNNNLNGSLPWCLETLMSSLSDLDLRNNSLSGSLPEIFMNATKLRSLDVSHNRMEGKLPGSLTGCSSLEVLNVGSNRINDMFPFELNSLQKLQVLVLHSNKFHGTLHNVDGVWFGFPQLQIIDVSHNDFFGILPSDYFMNWTAMSSKKDNNIEPEYIQNPSVYGSSLGYYTSLVLMSKGVSMEMERVLTIYTAIDLSGNQLHGKIPDSIGLLKELRILNMSSNGFTGHIPSSLANLKNLESLDISQNNISGEIPPELGTLSSLAWINVSHNQLVGSIPQGTQFQRQKCSSYEGNPGLNGPSLENVCGHIKESTPTQTEPLETKEEEEEESFSWIAAGLGFAPGVVFGLAMGYIVVSYKHQWFMKTFGRSKQQNTRTR


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
38-1005 PTHR24420,FAMILY NOT NAMED

KVFIFSEKMSFLIRSICFLILIPSFLITFVSATQHLCHSDQKDALLDFKNEFGMVDSKSWVNKSDCCSWDGITCDAKSGNVIGLDLSSIFLYGQLKSNSSLFKLRHLRDLNLANNNFNNSPIPAEFDKLTGLERLDLSQSSLSGQIPINLLQLTKLVSLDLSSSDFFGDESFHYLSIDKSFLPLLARNLRNLRELDMSYVKISSEIPEEFSNIRSLRSLNLNGCNLFGEFPSSILLIPNLQSIDLGNNPNLRGNLPVFHENNSLLKLTILYTSFSGAIPDSISSLKNLTSLTLSVSYFSGKIPFSLGNLSHLSHLSLSSNNLIGEIPSSIGNLNQLTNFYVGGNKLSGNLPATLSNLTKLNTISLSSNQFTGSLPPSISQLSKLKFFFADDNPFIGAILSPLLKIPSLTRIHLSYNQLNDLVGIENIFMLPNLETFYIYHYNYTKVRPLDLNVFSSLKQLGTLYISRIPISTTNITSDFPSNLEYLSLRSCNITDFPEFIRKGRNLQILDLSNNKIKGQVPDWLWRMPTLNSVDLSNNSLSGFHVSVKASPESQLTSVDLSSNAFQGPLFLPSKSLRYFSGSNNNFTGKIPRSICGLSSLEILDLSNNNLNGSLPWCLETLMSSLSDLDLRNNSLSGSLPEIFMNATKLRSLDVSHNRMEGKLPGSLTGCSSLEVLNVGSNRINDMFPFELNSLQKLQVLVLHSNKFHGTLHNVDGVWFGFPQLQIIDVSHNDFFGILPSDYFMNWTAMSSKKDNNIEPEYIQNPSVYGSSLGYYTSLVLMSKGVSMEMERVLTIYTAIDLSGNQLHGKIPDSIGLLKELRILNMSSNGFTGHIPSSLANLKNLESLDISQNNISGEIPPELGTLSSLAWINVSHNQLVGSIPQGTQFQRQKCSSYEGNPGLNGPSLENVCGHIKESTPTQTEPLETKEEEEEESFSWIAAGLGFAPGVVFGLAMGYIVVSYKHQWFM

HMMPanther: PTHR24420:SF913
38-1005 PTHR24420:SF913

KVFIFSEKMSFLIRSICFLILIPSFLITFVSATQHLCHSDQKDALLDFKNEFGMVDSKSWVNKSDCCSWDGITCDAKSGNVIGLDLSSIFLYGQLKSNSSLFKLRHLRDLNLANNNFNNSPIPAEFDKLTGLERLDLSQSSLSGQIPINLLQLTKLVSLDLSSSDFFGDESFHYLSIDKSFLPLLARNLRNLRELDMSYVKISSEIPEEFSNIRSLRSLNLNGCNLFGEFPSSILLIPNLQSIDLGNNPNLRGNLPVFHENNSLLKLTILYTSFSGAIPDSISSLKNLTSLTLSVSYFSGKIPFSLGNLSHLSHLSLSSNNLIGEIPSSIGNLNQLTNFYVGGNKLSGNLPATLSNLTKLNTISLSSNQFTGSLPPSISQLSKLKFFFADDNPFIGAILSPLLKIPSLTRIHLSYNQLNDLVGIENIFMLPNLETFYIYHYNYTKVRPLDLNVFSSLKQLGTLYISRIPISTTNITSDFPSNLEYLSLRSCNITDFPEFIRKGRNLQILDLSNNKIKGQVPDWLWRMPTLNSVDLSNNSLSGFHVSVKASPESQLTSVDLSSNAFQGPLFLPSKSLRYFSGSNNNFTGKIPRSICGLSSLEILDLSNNNLNGSLPWCLETLMSSLSDLDLRNNSLSGSLPEIFMNATKLRSLDVSHNRMEGKLPGSLTGCSSLEVLNVGSNRINDMFPFELNSLQKLQVLVLHSNKFHGTLHNVDGVWFGFPQLQIIDVSHNDFFGILPSDYFMNWTAMSSKKDNNIEPEYIQNPSVYGSSLGYYTSLVLMSKGVSMEMERVLTIYTAIDLSGNQLHGKIPDSIGLLKELRILNMSSNGFTGHIPSSLANLKNLESLDISQNNISGEIPPELGTLSSLAWINVSHNQLVGSIPQGTQFQRQKCSSYEGNPGLNGPSLENVCGHIKESTPTQTEPLETKEEEEEESFSWIAAGLGFAPGVVFGLAMGYIVVSYKHQWFM

Gene3D: G3DSA:3.80.10.10
74-322 G3DSA:3.80.10.10

CHSDQKDALLDFKNEFGMVDSKSWVNKSDCCSWDGITCDAKSGNVIGLDLSSIFLYGQLKSNSSLFKLRHLRDLNLANNNFNNSPIPAEFDKLTGLERLDLSQSSLSGQIPINLLQLTKLVSLDLSSSDFFGDESFHYLSIDKSFLPLLARNLRNLRELDMSYVKISSEIPEEFSNIRSLRSLNLNGCNLFGEFPSSILLIPNLQSIDLGNNPNLRGNLPVFHENNSLLKLTILYTSFSGAIPDSISSL

HMMPfam: PF08263
IPR013210
76-112 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

SDQKDALLDFKNEFGMVDSKSWVNKSDCCSWDGITCD

superfamily: SSF52047
120-457 SSF52047,LRR

GLDLSSIFLYGQLKSNSSLFKLRHLRDLNLANNNFNNSPIPAEFDKLTGLERLDLSQSSLSGQIPINLLQLTKLVSLDLSSSDFFGDESFHYLSIDKSFLPLLARNLRNLRELDMSYVKISSEIPEEFSNIRSLRSLNLNGCNLFGEFPSSILLIPNLQSIDLGNNPNLRGNLPVFHENNSLLKLTILYTSFSGAIPDSISSLKNLTSLTLSVSYFSGKIPFSLGNLSHLSHLSLSSNNLIGEIPSSIGNLNQLTNFYVGGNKLSGNLPATLSNLTKLNTISLSSNQFTGSLPPSISQLSKLKFFFADDNPFIGAILSPLLKIPSLTRIHLSYNQLND

ProfileScan: PS51450
IPR001611
143-164 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLRDLNLANNNFNNSPIPAEFD

ProfileScan: PS51450
IPR001611
168-189 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLERLDLSQSSLSGQIPINLLQ

HMMPfam: PF00560
IPR001611
228-249 LRR_1
Leucine-rich repeat

NLRELDMSYVKISSEIPEEFSN

ProfileScan: PS51450
IPR001611
228-249 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLRELDMSYVKISSEIPEEFSN

HMMPfam: PF13516
252-271 LRR_6,Leucine Rich repeat

SLRSLNLNGCNLFGEFPSSI

ProfileScan: PS51450
IPR001611
252-274 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRSLNLNGCNLFGEFPSSILLI

ProfileScan: PS51450
IPR001611
276-299 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQSIDLGNNPNLRGNLPVFHENN

Gene3D: G3DSA:3.80.10.10
323-433 G3DSA:3.80.10.10

KNLTSLTLSVSYFSGKIPFSLGNLSHLSHLSLSSNNLIGEIPSSIGNLNQLTNFYVGGNKLSGNLPATLSNLTKLNTISLSSNQFTGSLPPSISQLSKLKFFFADDNPFIG

HMMPfam: PF00560
IPR001611
348-370 LRR_1
Leucine-rich repeat

HLSHLSLSSNNLIGEIPSSIGNL

ProfileScan: PS51450
IPR001611
348-370 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLSHLSLSSNNLIGEIPSSIGNL

ProfileScan: PS51450
IPR001611
396-418 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLNTISLSSNQFTGSLPPSISQL

HMMPfam: PF00560
IPR001611
396-418 LRR_1
Leucine-rich repeat

KLNTISLSSNQFTGSLPPSISQL

Gene3D: G3DSA:3.80.10.10
443-598 G3DSA:3.80.10.10

PSLTRIHLSYNQLNDLVGIENIFMLPNLETFYIYHYNYTKVRPLDLNVFSSLKQLGTLYISRIPISTTNITSDFPSNLEYLSLRSCNITDFPEFIRKGRNLQILDLSNNKIKGQVPDWLWRMPTLNSVDLSNNSLSGFHVSVKASPESQLTSVDLS

ProfileScan: PS51450
IPR001611
444-465 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTRIHLSYNQLNDLVGIENIF

superfamily: SSF52058
516-781 SSF52058,LRR

FPSNLEYLSLRSCNITDFPEFIRKGRNLQILDLSNNKIKGQVPDWLWRMPTLNSVDLSNNSLSGFHVSVKASPESQLTSVDLSSNAFQGPLFLPSKSLRYFSGSNNNFTGKIPRSICGLSSLEILDLSNNNLNGSLPWCLETLMSSLSDLDLRNNSLSGSLPEIFMNATKLRSLDVSHNRMEGKLPGSLTGCSSLEVLNVGSNRINDMFPFELNSLQKLQVLVLHSNKFHGTLHNVDGVWFGFPQLQIIDVSHNDFFGILPSDYFM

HMMPfam: PF13855
518-577 LRR_8,Leucine rich repeat

SNLEYLSLRSCNITDFPEFIRKGRNLQILDLSNNKIKGQVPDWLWRMPTLNSVDLSNNSL

ProfileScan: PS51450
IPR001611
519-540 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEYLSLRSCNITDFPEFIRKG

ProfileScan: PS51450
IPR001611
542-564 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQILDLSNNKIKGQVPDWLWRM

ProfileScan: PS51450
IPR001611
566-587 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

TLNSVDLSNNSLSGFHVSVKAS

FPrintScan: PR00019
567-580 LEURICHRPT,Leucine-rich repeat signature

LNSVDLSNNSLSGF

Gene3D: G3DSA:3.80.10.10
599-668 G3DSA:3.80.10.10

SNAFQGPLFLPSKSLRYFSGSNNNFTGKIPRSICGLSSLEILDLSNNNLNGSLPWCLETLMSSLSDLDLR

FPrintScan: PR00019
634-647 LEURICHRPT,Leucine-rich repeat signature

LSSLEILDLSNNNL

ProfileScan: PS51450
IPR001611
636-659 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLEILDLSNNNLNGSLPWCLETLM

HMMPfam: PF00560
IPR001611
636-656 LRR_1
Leucine-rich repeat

SLEILDLSNNNLNGSLPWCLE

ProfileScan: PS51450
IPR001611
661-683 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLSDLDLRNNSLSGSLPEIFMNA

Gene3D: G3DSA:3.80.10.10
669-788 G3DSA:3.80.10.10

NNSLSGSLPEIFMNATKLRSLDVSHNRMEGKLPGSLTGCSSLEVLNVGSNRINDMFPFELNSLQKLQVLVLHSNKFHGTLHNVDGVWFGFPQLQIIDVSHNDFFGILPSDYFMNWTAMSS

HMMPfam: PF13855
685-743 LRR_8,Leucine rich repeat

KLRSLDVSHNRMEGKLPGSLTGCSSLEVLNVGSNRINDMFPFELNSLQKLQVLVLHSNK

ProfileScan: PS51450
IPR001611
685-707 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLRSLDVSHNRMEGKLPGSLTGC

ProfileScan: PS51450
IPR001611
709-730 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLEVLNVGSNRINDMFPFELNS

ProfileScan: PS51450
IPR001611
760-781 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLQIIDVSHNDFFGILPSDYFM

superfamily: SSF52058
782-948 SSF52058,LRR

NWTAMSSKKDNNIEPEYIQNPSVYGSSLGYYTSLVLMSKGVSMEMERVLTIYTAIDLSGNQLHGKIPDSIGLLKELRILNMSSNGFTGHIPSSLANLKNLESLDISQNNISGEIPPELGTLSSLAWINVSHNQLVGSIPQGTQFQRQKCSSYEGNPGLNGPSLENVC

ProfileScan: PS51450
IPR001611
832-854 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

IYTAIDLSGNQLHGKIPDSIGLL

Gene3D: G3DSA:3.80.10.10
836-942 G3DSA:3.80.10.10

IDLSGNQLHGKIPDSIGLLKELRILNMSSNGFTGHIPSSLANLKNLESLDISQNNISGEIPPELGTLSSLAWINVSHNQLVGSIPQGTQFQRQKCSSYEGNPGLNGP

ProfileScan: PS51450
IPR001611
856-879 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ELRILNMSSNGFTGHIPSSLANLK

HMMPfam: PF00560
IPR001611
857-878 LRR_1
Leucine-rich repeat

LRILNMSSNGFTGHIPSSLANL

HMMPfam: PF12799
879-915 LRR_4,Leucine Rich repeats (2 copies)

KNLESLDISQNNISGEIPPELGTLSSLAWINVSHNQL

ProfileScan: PS51450
IPR001611
880-902 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLESLDISQNNISGEIPPELGTL

ProfileScan: PS51450
IPR001611
904-926 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLAWINVSHNQLVGSIPQGTQFQ






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox