PRGDB00049097 (At2g17140)

From PRG Wiki
Jump to: navigation, search
At2g17140
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 6598355 (AC002354)
Gene Class CNL
Domain Type LRR, LRR, NBS, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana chromosome II section 98 of 255 of the complete sequence. Sequence from clones F12A24, F6P23.

DNA Sequence

ATGGATGCGGAGAAACTCGTGATCATTCCCATCTTCTACATCGTGACTCCATACACCATTAAAAAGCAGATGGGAGACTTTGGTGACAAGTTTAGAGTGCTGGTGGATTATGTTGATGATGTGACGGAGAAAAAATGGACTGATGCTTTGAAGTCTGTTCCCTTAATTTTAGGCATCACTTACGACGGGCAGAGCGAAGAACAACTTTTAATCAATCAAATCGTTGGGGAGGTTCAGAGAGTAATAAAGATAATTTCACAAGGAGAAGGAGATGAAAAAAATAAAATGGTGTGCACAAATACCTCTACAGGTTCAAGCTTTATCCCACAAAATAGAAACATGGTAGATCCTGAAAATCAAATTGAGCTCGTTGGACTCAGCCAACGCCTCAAGGAACTAAAAGAAAAGTTGGACCTTAGCCGCAAGGAAACTCGCATTGTTGGGGTTTTAGGGATGCCCGGAATCGGCAAGACCACACTGGTGAAGAGATTGTATGATGAGTGGAAACACAATTTCCAGCGTCACTTGCATATGGTGAATATCCGTCAGAAGTCGAAGGAATACGGGACGCATTCCCTAGAGAGAATGATTCTGAAAGAGTTGCTTAGCGACACTTACAATGATATAACTGAAGAGATGACGTACGCTTCTGTAAAGGATGAGCTGCTGAAGAAGAAAGTTCTTCTTGTTCTCGATGACGTGAGTAGCAAGAAACAAATACAAGGTCTTCTCGGGAATCTTAACTGGATTAGGAAAGGAAGCAGGATTGTTATTACTACGCGTGACAAGATATCCATAAGCCAGTTCGAGTATACTTATGTTGTCCCAAGATTGAATATCACAGATGGCTTAAAGCAATTCAGCTTTTATGCCTTTGAAGATCACAACTGTCCATACCCGGGGAATCTCATGGATCTTTCCACAAAGTTCGTAGATTATGCCAGAGGCAATCCCTTAGCTCTCAAGATATTGGGTCGGGAGCTTCTTTCGATAGACAAGGATCAGTGGCCAAAGAGACTCGATACTCTGGCACAACTTCCCATCCCGTATATACAGGATCTATTGAGAGCAAGTTATGATGATCTGAGCAATCAACAGAAAGAAGTTTTTCTTGTCGTAGCCTGGTTCTTTGGATCAGGGGATGAATATTACATTAGGAGTTTAGTGGATACAGAAGATCCTGATTCTGCCGATGATGCTGCTAGCGAAGTAAGAGATTTCGCAGGCAACTTACTAATTAGCATCTCAAGTGGTCGATTGGAGATGCATGATTTAATGGCTACGTTCGCCAAAAAACTTTGTTCATCCTTATCTAATGAAAATAACTATGGATACCAAATGATTTGGAATCATGAAAGCTTTAATGCTGCGGCTAAAAATAAAAGGATGAGATATGTCAATCAACCAAGGAAAAAAGTCACAGAATCGGAAATGGACAATGTCATGGGTATATTGCTGGACGTGTCTGAAATGGATAATAACATGACCTTAGATTCTAAATTCTTCAGCGAGATGTGCAATCTACGGTACCTCAAAGTCTACAATTCACAATGCTCTCGAGATTGTGATGTTGGTTGCAAACTGACCTTCCCAGATGGACTTAAATGCTCAATGGAAAATGTCCGATATCTCTATTGGCTACAATTCCCATTGAAGAAGCTTTCAAAAGCATTTAACCCTAAGAATCTTATCGAGCTCAACCTCCCTTACAGCAAAATTACACGACTTTGGAAGGAAAGTAAGGAAATATCCAAACTAAAATGGGTCGATCTCAGCCACTCGAGTGAGCTATGCGATATATCAGGGTTAATAGGAGCTCATAATATTAGAAGATTGAATCTTGAAGGCTGCATAGAATTGAAAACATTACCACAAGAGATGCAAGAAATGGAAAGTCTGATTTATCTAAACCTGGGAGGATGCACGCGTCTTGTGTCTCTTCCAGAGTTTAAGTTGAAATCCCTAAAGACTCTCATCTTAAGTCACTGCAAGAACTTTGAACAATTTCCGGTTATTTCAGAATGTTTAGAAGCTCTTTACTTGCAAGGCACGGCAATAAAGTGTATTCCTACCTCCATTGAGAACCTTCAGAAACTAATCCTATTGGATCTAAAAGACTGCGAAGTATTGGTAAGTCTTCCTGATTGTCTTGGAAATCTAAGATCTCTTCAAGAGCTAATACTCTCTGGCTGCTCAAAGTTAAAGTTTTTTCCAGAGTTGAAGGAGACCATGAAATCAATAAAGATTTTGCTGCTTGATGGAACAGCCATTAAGCAGATGCCAATATTATTGCAGTGTATTCAGTCACAAGGCCACTCTGTTGCAAATAAGACGCTTCCAAACAGTTTAAGTGATTACTACCTACCTTCCTCATTGTTGTCTTTATGCTTAAGTGGAAATGATATCGAGAGCTTGCATGCTAACATCAGCCAGCTTTATCATCTGAAATGGCTTGACTTGAAGAATTGCAAGAAGCTTAAATCTGTGTCGGTGCTTCCACCAAACCTCAAGTGCTTAGATGCACATGGTTGTGACTCACTGGAAGAAGTTGGAAGCCCTCTAGCGGTTCTCATGGTGACAGGAAAAATCCATTGCACATACATTTTCACAAACTGCAACAAATTGGATCAAGTTGCAGAAAGTAACATCATATCTTTCACTTGGAGGAAAAGCCAGATGATGTCAGATGCTCTGAATCGCTACAATGGGGGATTTGTTTTGGAATCTTTGGTCAGCACTTGCTTTCCTGGATGTGAAGTACCTGCATCATTCGATCACCAAGCCTATGGAGCATTGTTACAGACGAAATTACCTCGGCACTGGTGTGATAGTAGGCTTACTGGGATAGCTTTATGCGCTGTTATATTGTTTCCGGACTACCAACATCAAAGCAATCGTTTCTTGGTGAAATGCACTTGTGAGTTCGGAACTGAAGATGGGCCATGTATCAGCTTTAGTTCCATTGTTGGAGGTTGGAGCGAACCAGGCTATGAGCCACGACTATTAAACATTAACAAACGTCACGTGGAAAAGCATGGGAATGGATGTATTCCTTCTAAGGCTTCACTCAGATTTCAAGTCACAGATGGTGCGAGTGAGGTAGGAAATTGCCATGTCCTGAAATGTGGCTTTACTTTAGTGTATACACCAAACGATAGTGATGATATCTCTCCGGCGAGAGTAGTTGATATCACTACACGGGATAAGGAGGATGGCCTAGAAAATGCAACTTCTAACAAACTTTCAAGAAACGATTATGAATTCTCGCATCAGTCAAACTGTGGAGTGACTTCGAGAAGGGATGAATGTTTCCTTTCTGAAGAGCTTCCATAA


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Arabidopsis thaliana].

MDAEKLVIIPIFYIVTPYTIKKQMGDFGDKFRVLVDYVDDVTEKKWTDALKSVPLILGITYDGQSEEQLLINQIVGEVQRVIKIISQGEGDEKNKMVCTNTSTGSSFIPQNRNMVDPENQIELVGLSQRLKELKEKLDLSRKETRIVGVLGMPGIGKTTLVKRLYDEWKHNFQRHLHMVNIRQKSKEYGTHSLERMILKELLSDTYNDITEEMTYASVKDELLKKKVLLVLDDVSSKKQIQGLLGNLNWIRKGSRIVITTRDKISISQFEYTYVVPRLNITDGLKQFSFYAFEDHNCPYPGNLMDLSTKFVDYARGNPLALKILGRELLSIDKDQWPKRLDTLAQLPIPYIQDLLRASYDDLSNQQKEVFLVVAWFFGSGDEYYIRSLVDTEDPDSADDAASEVRDFAGNLLISISSGRLEMHDLMATFAKKLCSSLSNENNYGYQMIWNHESFNAAAKNKRMRYVNQPRKKVTESEMDNVMGILLDVSEMDNNMTLDSKFFSEMCNLRYLKVYNSQCSRDCDVGCKLTFPDGLKCSMENVRYLYWLQFPLKKLSKAFNPKNLIELNLPYSKITRLWKESKEISKLKWVDLSHSSELCDISGLIGAHNIRRLNLEGCIELKTLPQEMQEMESLIYLNLGGCTRLVSLPEFKLKSLKTLILSHCKNFEQFPVISECLEALYLQGTAIKCIPTSIENLQKLILLDLKDCEVLVSLPDCLGNLRSLQELILSGCSKLKFFPELKETMKSIKILLLDGTAIKQMPILLQCIQSQGHSVANKTLPNSLSDYYLPSSLLSLCLSGNDIESLHANISQLYHLKWLDLKNCKKLKSVSVLPPNLKCLDAHGCDSLEEVGSPLAVLMVTGKIHCTYIFTNCNKLDQVAESNIISFTWRKSQMMSDALNRYNGGFVLESLVSTCFPGCEVPASFDHQAYGALLQTKLPRHWCDSRLTGIALCAVILFPDYQHQSNRFLVKCTCEFGTEDGPCISFSSIVGGWSEPGYEPRLLNINKRHVEKHGNGCIPSKASLRFQVTDGASEVGNCHVLKCGFTLVYTPNDSDDISPARVVDITTRDKEDGLENATSNKLSRNDYEFSHQSNCGVTSRRDECFLSEELP

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF245
1-888 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

MDAEKLVIIPIFYIVTPYTIKKQMGDFGDKFRVLVDYVDDVTEKKWTDALKSVPLILGITYDGQSEEQLLINQIVGEVQRVIKIISQGEGDEKNKMVCTNTSTGSSFIPQNRNMVDPENQIELVGLSQRLKELKEKLDLSRKETRIVGVLGMPGIGKTTLVKRLYDEWKHNFQRHLHMVNIRQKSKEYGTHSLERMILKELLSDTYNDITEEMTYASVKDELLKKKVLLVLDDVSSKKQIQGLLGNLNWIRKGSRIVITTRDKISISQFEYTYVVPRLNITDGLKQFSFYAFEDHNCPYPGNLMDLSTKFVDYARGNPLALKILGRELLSIDKDQWPKRLDTLAQLPIPYIQDLLRASYDDLSNQQKEVFLVVAWFFGSGDEYYIRSLVDTEDPDSADDAASEVRDFAGNLLISISSGRLEMHDLMATFAKKLCSSLSNENNYGYQMIWNHESFNAAAKNKRMRYVNQPRKKVTESEMDNVMGILLDVSEMDNNMTLDSKFFSEMCNLRYLKVYNSQCSRDCDVGCKLTFPDGLKCSMENVRYLYWLQFPLKKLSKAFNPKNLIELNLPYSKITRLWKESKEISKLKWVDLSHSSELCDISGLIGAHNIRRLNLEGCIELKTLPQEMQEMESLIYLNLGGCTRLVSLPEFKLKSLKTLILSHCKNFEQFPVISECLEALYLQGTAIKCIPTSIENLQKLILLDLKDCEVLVSLPDCLGNLRSLQELILSGCSKLKFFPELKETMKSIKILLLDGTAIKQMPILLQCIQSQGHSVANKTLPNSLSDYYLPSSLLSLCLSGNDIESLHANISQLYHLKWLDLKNCKKLKSVSVLPPNLKCLDAHGCDSLEEVGSPLAVLMVTGKIHCTYIFTNCNKLDQVAESNIISFTW

HMMPanther: PTHR23155
1-888 FAMILY NOT NAMED,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

MDAEKLVIIPIFYIVTPYTIKKQMGDFGDKFRVLVDYVDDVTEKKWTDALKSVPLILGITYDGQSEEQLLINQIVGEVQRVIKIISQGEGDEKNKMVCTNTSTGSSFIPQNRNMVDPENQIELVGLSQRLKELKEKLDLSRKETRIVGVLGMPGIGKTTLVKRLYDEWKHNFQRHLHMVNIRQKSKEYGTHSLERMILKELLSDTYNDITEEMTYASVKDELLKKKVLLVLDDVSSKKQIQGLLGNLNWIRKGSRIVITTRDKISISQFEYTYVVPRLNITDGLKQFSFYAFEDHNCPYPGNLMDLSTKFVDYARGNPLALKILGRELLSIDKDQWPKRLDTLAQLPIPYIQDLLRASYDDLSNQQKEVFLVVAWFFGSGDEYYIRSLVDTEDPDSADDAASEVRDFAGNLLISISSGRLEMHDLMATFAKKLCSSLSNENNYGYQMIWNHESFNAAAKNKRMRYVNQPRKKVTESEMDNVMGILLDVSEMDNNMTLDSKFFSEMCNLRYLKVYNSQCSRDCDVGCKLTFPDGLKCSMENVRYLYWLQFPLKKLSKAFNPKNLIELNLPYSKITRLWKESKEISKLKWVDLSHSSELCDISGLIGAHNIRRLNLEGCIELKTLPQEMQEMESLIYLNLGGCTRLVSLPEFKLKSLKTLILSHCKNFEQFPVISECLEALYLQGTAIKCIPTSIENLQKLILLDLKDCEVLVSLPDCLGNLRSLQELILSGCSKLKFFPELKETMKSIKILLLDGTAIKQMPILLQCIQSQGHSVANKTLPNSLSDYYLPSSLLSLCLSGNDIESLHANISQLYHLKWLDLKNCKKLKSVSVLPPNLKCLDAHGCDSLEEVGSPLAVLMVTGKIHCTYIFTNCNKLDQVAESNIISFTW

Gene3D: G3DSA:3.40.50.300
120-259 no description

QIELVGLSQRLKELKEKLDLSRKETRIVGVLGMPGIGKTTLVKRLYDEWKHNFQRHLHMVNIRQKSKEYGTHSLERMILKELLSDTYNDITEEMTYASVKDELLKKKVLLVLDDVSSKKQIQGLLGNLNWIRKGSRIVIT

superfamily: SSF52540
122-351 P-loop containing nucleoside triphosphate hydrolases

ELVGLSQRLKELKEKLDLSRKETRIVGVLGMPGIGKTTLVKRLYDEWKHNFQRHLHMVNIRQKSKEYGTHSLERMILKELLSDTYNDITEEMTYASVKDELLKKKVLLVLDDVSSKKQIQGLLGNLNWIRKGSRIVITTRDKISISQFEYTYVVPRLNITDGLKQFSFYAFEDHNCPYPGNLMDLSTKFVDYARGNPLALKILGRELLSIDKDQWPKRLDTLAQLPIPYI

Coil: coil
123-144 coiled-coil

LVGLSQRLKELKEKLDLSRKET

HMMPfam: PF00931
IPR002182
128-377 NB-ARC,NBS
NB-ARC

QRLKELKEKLDLSRKETRIVGVLGMPGIGKTTLVKRLYDEWKHNFQRHLHMVNIRQKSKEYGTHSLERMILKELLSDTYNDITEEMTYASVKDELLKKKVLLVLDDVSSKKQIQGLLGNLNWIRKGSRIVITTRDKISISQFEYTYVVPRLNITDGLKQFSFYAFEDHNCPYPGNLMDLSTKFVDYARGNPLALKILGRELLSIDKDQWPKRLDTLAQLPIPYIQDLLRASYDDLSNQQKEVFLVVAWFF

FPrintScan: PR00364
IPR000767
146-161 DISEASERSIST
Disease resistance protein

IVGVLGMPGIGKTTLV

Seg: seg
217-238 seg

SVKDELLKKKVLLVLDDVSSKK

FPrintScan: PR00364
IPR000767
221-235 DISEASERSIST
Disease resistance protein

ELLKKKVLLVLDDVS

FPrintScan: PR00364
IPR000767
314-328 DISEASERSIST
Disease resistance protein

ARGNPLALKILGREL

Seg: seg
395-402 seg

DSADDAAS

superfamily: SSF52058
469-863 L domain-like,LRR

PRKKVTESEMDNVMGILLDVSEMDNNMTLDSKFFSEMCNLRYLKVYNSQCSRDCDVGCKLTFPDGLKCSMENVRYLYWLQFPLKKLSKAFNPKNLIELNLPYSKITRLWKESKEISKLKWVDLSHSSELCDISGLIGAHNIRRLNLEGCIELKTLPQEMQEMESLIYLNLGGCTRLVSLPEFKLKSLKTLILSHCKNFEQFPVISECLEALYLQGTAIKCIPTSIENLQKLILLDLKDCEVLVSLPDCLGNLRSLQELILSGCSKLKFFPELKETMKSIKILLLDGTAIKQMPILLQCIQSQGHSVANKTLPNSLSDYYLPSSLLSLCLSGNDIESLHANISQLYHLKWLDLKNCKKLKSVSVLPPNLKCLDAHGCDSLEEVGSPLAVLMVTGKI

Gene3D: G3DSA:3.80.10.10
497-764 no description

LDSKFFSEMCNLRYLKVYNSQCSRDCDVGCKLTFPDGLKCSMENVRYLYWLQFPLKKLSKAFNPKNLIELNLPYSKITRLWKESKEISKLKWVDLSHSSELCDISGLIGAHNIRRLNLEGCIELKTLPQEMQEMESLIYLNLGGCTRLVSLPEFKLKSLKTLILSHCKNFEQFPVISECLEALYLQGTAIKCIPTSIENLQKLILLDLKDCEVLVSLPDCLGNLRSLQELILSGCSKLKFFPELKETMKSIKILLLDGTAIKQMPILL

HMMPfam: PF07725
IPR011713
562-579 LRR_3
Leucine-rich repeat 3

NLIELNLPYSKITRLWKE

HMMPfam: PF00560
IPR001611
632-653 LRR_1
Leucine-rich repeat

SLIYLNLGGCTRLVSLPEFKLK

FPrintScan: PR00364
IPR000767
650-666 DISEASERSIST
Disease resistance protein

FKLKSLKTLILSHCKNF

HMMPfam: PF13855
676-731 LRR_8,Leucine rich repeat

LEALYLQGTAIKCIPTSIENLQKLILLDLKDCEVLVSLPDCLGNLRSLQELILSGC

Gene3D: G3DSA:3.80.10.10
779-848 no description

LPNSLSDYYLPSSLLSLCLSGNDIESLHANISQLYHLKWLDLKNCKKLKSVSVLPPNLKCLDAHGCDSLE

Seg: seg
779-798 seg

LPNSLSDYYLPSSLLSLCLS


List of References

X Lin, S Kaul, S Rounsley, T P Shea, M I Benito, C D Town, C Y Fujii, T Mason, C L Bowman, M Barnstead, T V Feldblyum, C R Buell, K A Ketchum, J Lee, C M Ronning, H L Koo, K S Moffat, L A Cronin, M Shen, G Pai, S Van Aken, L Umayam, L J Tallon, J E Gill, M D Adams, A J Carrera, T H Creasy, H M Goodman, C R Somerville, G P Copenhaver, D Preuss, W C Nierman, O White, J A Eisen, S L Salzberg, C M Fraser, J C Venter
Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana.
Nature: 1999, 402(6763);761-8
PubMed:10617197 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox