PRGDB00049098 (At2g17140)

From PRG Wiki
Jump to: navigation, search
At2g17140
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 6598355 (AC002354)
Gene Class TNL
Domain Type LRR, LRR, NBS, LRR, LRR, TIR, Others
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana chromosome II section 98 of 255 of the complete sequence. Sequence from clones F12A24, F6P23.

DNA Sequence

GAAGAGGAGAACATGGAAAACTTTAAGAGAAACGTTTACGATGAGATGAACGGTGTGCGCATCATTCCAATCTGGCATGTATATGCATTTTTGTTGATTTATCTGTTTCTTCTTATTTTAAAATCACGCTTTATACTACGAGACGTGATCCACAAGTGATGAGGATGTCCCAAGATATTTTGTCAGCTATTTAATCAAGAAATTAAAATGGATTGGCATTACTGTAGTATATAGTGGATTCATGGGAGGCAAGTCTATGAGTCGTCCCGAGGTAACACAAGCCATAGAAGAATCAAGTATCTCAGTCGTCATTCTATCAAAAGACTATGTTTCTTCAAGTAAGTGCTTGGATGAATTGGTGGAGATCATAAGGTGGAGGGAAGAAAACTTGGGAAACAGAGTGATGCCAATTTACTATGAAATGGGTACATCTGATGTAATGAAGCAAGCCAAAACTATTGGGAATAGATTGGTGGAAACCTATTTGGGGAAAGTAGTAGAGAAACCAGAGCTGAGATGGATGAGAGCTTTGGCATACATTGTCAATATAAACCTTGAGATGTTGAAGATGGTCAGGCTTAGTCACTCGCAAGATCTAGTTGAAATTGAAGAACTGATAAAATCTAAAAATATTGAAGTAATCGATCTCCAAGGTTGTACAAAAATACAGAGTTTTCCAGCTACAAGACATCTACAACATCTCAGAGTTATTAATCTTTCTGGTTGCGTTGAGATCAAAAGCACACAGCTCGAAGAATTTCAGGGCTTTCCAAGGAACCTGAAAGAATTATATCTTTCTGGTACTGGGATAAGAGAAGTGACATCATCAATCCACCTCTCCTCACTTGAAGTTTTGGATTTGTCTAACTGCAAAAGACTTCAAAACTTGCCCATGGGAAAGGGTAATTTGGCTTCTCTTATTAAACTCATGTTATCAGGGTGTTCAAAGCTCCAGAATATTCAAGATCTCCCAACAAACCTGAAAGAGCTATATCTTGCTGGGACCTCTATAAGAGAAGTTCCATCATCAATCTGTCATCTCACTCAACTTGTTGTTTTCGATGCCGAGAACTGCAAGAAGCTTCAAGACTTGCCTATGGGAATGGGTAATTTGATCTCTCTGACTATGTTAATTTTATCTGGCTGCTCAGAGCTCAGGAGTATCCCCGATCTTCCACGGAACCTTAGACATTTAAATCTAGCCGAGACCCCCATAAAGAAACTGCCATCATCATTTGAGGATCTCACTAAACTGGTTTCACTAGATTTGAATCACTGCGAAAGGCTTCAACATCTCCAAATGGAATCTTTCGAATCAGTAGTTAGGGTGGATCTATCTGGCTGCTTAGAGCTGAAGTATATCCTAGGTTTCTCACTTCAAGACATTACACAACTTCATGAAGATGGGACCGACAAAGTGATGTTACATGGAACTCCTCCATGTAACGTCACCTTAATTTTAGAGACGTGGAGAACAAGACATGTCACTCCAATGGAAAAGAGTGGGGTACTACTGAAGATATTGAAGTCATATTTCTAGACATGTCTAACTTGAAATTCTTTGTCAAACCTGATGCTTTCAAGAGTATGCATAATCTTAGATTTCTGAAGATTTATAGTTCTAATCCTGGAAAGCATCAGAGAATTCGCTTTCGAGAAGCTCTTCAGTCTCTTCCCAATGAGCTACGGCTACTCCACTGGGAGGATTATCCTCTACAATCCCTGCCACAACATTTTGATCCTACGCACCTTGTTGAACTCAACATGCCTTACAGTAAACTTCAAAAACTTTGGGGTGGAACCAAGATGGATTATGGTGCTTGTGAACTAGTGGAAGACATTGCTAGGGATATGTATGAAAAGATTTTCCCTACCAAACGAATTGGGATCTACAGGAAGATGCTGAAGTTAGAAAAAATTGTTTACAAGCAACTATGGGGTATCCGCAGCATAGGCATATGGGGTATGCCAGGCATAGGAAAAACAACACTTGCCGAAGCAGCATTTGACCAATTTTCTGGTGATTATGAAGCTTCTTGCATCATCAAAGACTTCGACAAAGAATTTCTTGCGAAAGGACTTTATCATTTGTGGAATGAATACTTAGGGGAAAATATAAACAATTCTTTTATCAAGTCCGGACAAAAAAGACTTCTTATCGTCCTTGACAATGTTCTTAAACCTCTGGATGCAGACGCTTTTCTTAATGGGTTTGATTGGTTTGGTCCAGGGAGCCTGATAATCATAACCTCTAGAGATAAACAAGTACTAGTGCAGTGTGGCGTCAACCAAATATATGAGGTTGAAGGTTTAAACAAAGATGAGGCTAAGCAACTACTTCACGGATGCGCATTTGGAATAGACTGGAGAAAACAGAGTGGGTTGGAAACTCTTGCACCTTACTATATTTCTGTCAAATATTTTAGTGGAAACCCTCTAGCTCTTAGCCTTTATGAAGAAATGTTGTCACACATGAAGTCAGATAAAATGGAGGTTAAGCTCCTCAAGCTCAACCACCCTCCACCTCAGATTATGGAAGTATTCAAGAGCAATTACAATGCACTTAATGAGAACGAGAAGAGCATGTTTCTAGACATTGCTTGTTTCTTCAGGGGAGAAAAGGCGGACTACGTGATGCAACTGTTTGAAGGATGTGGATTCTTTCCACATGTTGGAATATATGTTCTAGTGGATAAGTGTCTGGTGACTATTGTAAAAAGAAAGATGGAAATGCATAATCTGATCCAGATTGTTGGGAAGGCGATTTCAAATGAAGGAACTGTAGAACTTGATAGGCATGTCAGACTATGGGACACTTCAATCATTCAACCTCTGCTAGAAGATGAAGAAACCAAATTAAAGGGTGAATCTAAG


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Arabidopsis thaliana].

MDYGACELVEDIARDMYEKIFPTKRIGIYRKMLKLEKIVYKQLWGIRSIGIWGMPGIGKTTLAEAAFDQFSGDYEASCIIKDFDKEFLAKGLYHLWNEYLGENINNSFIKSGQKRLLIVLDNVLKPLDADAFLNGFDWFGPGSLIIITSRDKQVLVQCGVNQIYEVEGLNKDEAKQLLHGCAFGIDWRKQSGLETLAPYYISVKYFSGNPLALSLYEEMLSHMKSDKMEVKLLKLNHPPPQIMEVFKSNYNALNENEKSMFLDIACFFRGEKADYVMQLFEGCGFFPHVGIYVLVDKCLVTIVKRKMEMHNLIQIVGKAISNEGTVELDRHVRLWDTSIIQPLLEDEETKLKGESKGTTEDIEVIFLDMSNLKFFVKPDAFKSMHNLRFLKIYSSNPGKHQRIRFREALQSLPNELRLLHWEDYPLQSLPQHFDPTHLVELNMPYSKLQKLWGGTKNLEMLKMVRLSHSQDLVEIEELIKSKNIEVIDLQGCTKIQSFPATRHLQHLRVINLSGCVEIKSTQLEEFQGFPRNLKELYLSGTGIREVTSSIHLSSLEVLDLSNCKRLQNLPMGKGNLASLIKLMLSGCSKLQNIQDLPTNLKELYLAGTSIREVPSSICHLTQLVVFDAENCKKLQDLPMGMGNLISLTMLILSGCSELRSIPDLPRNLRHLNLAETPIKKLPSSFEDLTKLVSLDLNHCERLQHLQMESFESVVRVDLSGCLELKYILGFSLQDITQLHEDGTDKVMLHGTPPCNVTLILETWRTRHVTPMEKSGEDVPRYFVSYLIKKLKWIGITVVYSGFMGGKSMSRPEVTQAIEESSISVVILSKDYVSSSKCLDELVEIIRWREENLGNRVMPIYYEMGTSDVMKQAKTIGNRLVETYLGKVVEKPELRWMRALAYIVNIEEENMENFKRNVYDEMNGVRIIPIWHVYAFLLIYLFLLILKSRFILRDVIHK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR11017:SF20
7-727 SUBFAMILY NOT NAMED,SUBFAMILY NOT NAMED

ELVEDIARDMYEKIFPTKRIGIYRKMLKLEKIVYKQLWGIRSIGIWGMPGIGKTTLAEAAFDQFSGDYEASCIIKDFDKEFLAKGLYHLWNEYLGENINNSFIKSGQKRLLIVLDNVLKPLDADAFLNGFDWFGPGSLIIITSRDKQVLVQCGVNQIYEVEGLNKDEAKQLLHGCAFGIDWRKQSGLETLAPYYISVKYFSGNPLALSLYEEMLSHMKSDKMEVKLLKLNHPPPQIMEVFKSNYNALNENEKSMFLDIACFFRGEKADYVMQLFEGCGFFPHVGIYVLVDKCLVTIVKRKMEMHNLIQIVGKAISNEGTVELDRHVRLWDTSIIQPLLEDEETKLKGESKGTTEDIEVIFLDMSNLKFFVKPDAFKSMHNLRFLKIYSSNPGKHQRIRFREALQSLPNELRLLHWEDYPLQSLPQHFDPTHLVELNMPYSKLQKLWGGTKNLEMLKMVRLSHSQDLVEIEELIKSKNIEVIDLQGCTKIQSFPATRHLQHLRVINLSGCVEIKSTQLEEFQGFPRNLKELYLSGTGIREVTSSIHLSSLEVLDLSNCKRLQNLPMGKGNLASLIKLMLSGCSKLQNIQDLPTNLKELYLAGTSIREVPSSICHLTQLVVFDAENCKKLQDLPMGMGNLISLTMLILSGCSELRSIPDLPRNLRHLNLAETPIKKLPSSFEDLTKLVSLDLNHCERLQHLQMESFESVVRVDLSGCLELKYI

HMMPanther: PTHR11017
7-727 FAMILY NOT NAMED,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

ELVEDIARDMYEKIFPTKRIGIYRKMLKLEKIVYKQLWGIRSIGIWGMPGIGKTTLAEAAFDQFSGDYEASCIIKDFDKEFLAKGLYHLWNEYLGENINNSFIKSGQKRLLIVLDNVLKPLDADAFLNGFDWFGPGSLIIITSRDKQVLVQCGVNQIYEVEGLNKDEAKQLLHGCAFGIDWRKQSGLETLAPYYISVKYFSGNPLALSLYEEMLSHMKSDKMEVKLLKLNHPPPQIMEVFKSNYNALNENEKSMFLDIACFFRGEKADYVMQLFEGCGFFPHVGIYVLVDKCLVTIVKRKMEMHNLIQIVGKAISNEGTVELDRHVRLWDTSIIQPLLEDEETKLKGESKGTTEDIEVIFLDMSNLKFFVKPDAFKSMHNLRFLKIYSSNPGKHQRIRFREALQSLPNELRLLHWEDYPLQSLPQHFDPTHLVELNMPYSKLQKLWGGTKNLEMLKMVRLSHSQDLVEIEELIKSKNIEVIDLQGCTKIQSFPATRHLQHLRVINLSGCVEIKSTQLEEFQGFPRNLKELYLSGTGIREVTSSIHLSSLEVLDLSNCKRLQNLPMGKGNLASLIKLMLSGCSKLQNIQDLPTNLKELYLAGTSIREVPSSICHLTQLVVFDAENCKKLQDLPMGMGNLISLTMLILSGCSELRSIPDLPRNLRHLNLAETPIKKLPSSFEDLTKLVSLDLNHCERLQHLQMESFESVVRVDLSGCLELKYI

superfamily: SSF52540
13-235 P-loop containing nucleoside triphosphate hydrolases

ARDMYEKIFPTKRIGIYRKMLKLEKIVYKQLWGIRSIGIWGMPGIGKTTLAEAAFDQFSGDYEASCIIKDFDKEFLAKGLYHLWNEYLGENINNSFIKSGQKRLLIVLDNVLKPLDADAFLNGFDWFGPGSLIIITSRDKQVLVQCGVNQIYEVEGLNKDEAKQLLHGCAFGIDWRKQSGLETLAPYYISVKYFSGNPLALSLYEEMLSHMKSDKMEVKLLKL

HMMPfam: PF00931
IPR002182
46-287 NB-ARC,NBS
NB-ARC

IRSIGIWGMPGIGKTTLAEAAFDQFSGDYEASCIIKDFDKEFLAKGLYHLWNEYLGENINNSFIKSGQKRLLIVLDNVLKPLDADAFLNGFDWFGPGSLIIITSRDKQVLVQCGVNQIYEVEGLNKDEAKQLLHGCAFGIDWRKQSGLETLAPYYISVKYFSGNPLALSLYEEMLSHMKSDKMEVKLLKLNHPPPQIMEVFKSNYNALNENEKSMFLDIACFFRGEKADYVMQLFEGCGFFP

Gene3D: G3DSA:3.40.50.300
46-151 no description

IRSIGIWGMPGIGKTTLAEAAFDQFSGDYEASCIIKDFDKEFLAKGLYHLWNEYLGENINNSFIKSGQKRLLIVLDNVLKPLDADAFLNGFDWFGPGSLIIITSRD

FPrintScan: PR00364
IPR000767
48-63 DISEASERSIST
Disease resistance protein

SIGIWGMPGIGKTTLA

FPrintScan: PR00364
IPR000767
110-124 DISEASERSIST
Disease resistance protein

KSGQKRLLIVLDNVL

FPrintScan: PR00364
IPR000767
206-220 DISEASERSIST
Disease resistance protein

FSGNPLALSLYEEML

superfamily: SSF52058
339-740 L domain-like,LRR

IIQPLLEDEETKLKGESKGTTEDIEVIFLDMSNLKFFVKPDAFKSMHNLRFLKIYSSNPGKHQRIRFREALQSLPNELRLLHWEDYPLQSLPQHFDPTHLVELNMPYSKLQKLWGGTKNLEMLKMVRLSHSQDLVEIEELIKSKNIEVIDLQGCTKIQSFPATRHLQHLRVINLSGCVEIKSTQLEEFQGFPRNLKELYLSGTGIREVTSSIHLSSLEVLDLSNCKRLQNLPMGKGNLASLIKLMLSGCSKLQNIQDLPTNLKELYLAGTSIREVPSSICHLTQLVVFDAENCKKLQDLPMGMGNLISLTMLILSGCSELRSIPDLPRNLRHLNLAETPIKKLPSSFEDLTKLVSLDLNHCERLQHLQMESFESVVRVDLSGCLELKYILGFSLQDITQLHE

Gene3D: G3DSA:3.80.10.10
364-515 no description

VIFLDMSNLKFFVKPDAFKSMHNLRFLKIYSSNPGKHQRIRFREALQSLPNELRLLHWEDYPLQSLPQHFDPTHLVELNMPYSKLQKLWGGTKNLEMLKMVRLSHSQDLVEIEELIKSKNIEVIDLQGCTKIQSFPATRHLQHLRVINLSGC

HMMPfam: PF07725
IPR011713
437-456 LRR_3
Leucine-rich repeat 3

HLVELNMPYSKLQKLWGGTK

Gene3D: G3DSA:3.80.10.10
516-738 no description

VEIKSTQLEEFQGFPRNLKELYLSGTGIREVTSSIHLSSLEVLDLSNCKRLQNLPMGKGNLASLIKLMLSGCSKLQNIQDLPTNLKELYLAGTSIREVPSSICHLTQLVVFDAENCKKLQDLPMGMGNLISLTMLILSGCSELRSIPDLPRNLRHLNLAETPIKKLPSSFEDLTKLVSLDLNHCERLQHLQMESFESVVRVDLSGCLELKYILGFSLQDITQL

FPrintScan: PR00364
IPR000767
550-566 DISEASERSIST
Disease resistance protein

IHLSSLEVLDLSNCKRL

HMMPfam: PF00560
IPR001611
554-570 LRR_1
Leucine-rich repeat

SLEVLDLSNCKRLQNLP

HMMPfam: PF12799
667-699 LRR_4,Leucine Rich repeats (2 copies)

NLRHLNLAETPIKKLPSSFEDLTKLVSLDLNHC

HMMSmart: SM00255
IPR000157
773-905 Toll
Toll/interleukin-1 receptor homology (TIR) domain

KSGEDVPRYFVSYLIKKLKWIGITVVYSGFMGGKSMSRPEVTQAIEESSISVVILSKDYVSSSKCLDELVEIIRWREENLGNRVMPIYYEMGTSDVMKQAKTIGNRLVETYLGKVVEKPELRWMRALAYIVNI

superfamily: SSF52200
IPR000157
774-908 Toll/Interleukin receptor TIR domain
Toll/interleukin-1 receptor homology (TIR) domain

SGEDVPRYFVSYLIKKLKWIGITVVYSGFMGGKSMSRPEVTQAIEESSISVVILSKDYVSSSKCLDELVEIIRWREENLGNRVMPIYYEMGTSDVMKQAKTIGNRLVETYLGKVVEKPELRWMRALAYIVNIEEE

HMMPfam: PF01582
IPR000157
775-899 TIR
Toll/interleukin-1 receptor homology (TIR) domain

GEDVPRYFVSYLIKKLKWIGITVVYSGFMGGKSMSRPEVTQAIEESSISVVILSKDYVSSSKCLDELVEIIRWREENLGNRVMPIYYEMGTSDVMKQAKTIGNRLVETYLGKVVEKPELRWMRAL

Gene3D: G3DSA:3.40.50.10140
802-884 no description

FMGGKSMSRPEVTQAIEESSISVVILSKDYVSSSKCLDELVEIIRWREENLGNRVMPIYYEMGTSDVMKQAKTIGNRLVETYL

ProfileScan: PS50104
IPR000157
805-905 TIR
Toll/interleukin-1 receptor homology (TIR) domain

GKSMSRPEVTQAIEESSISVVILSKDYVSSSKCLDELVEIIRWREENLGNRVMPIYYEMGTSDVMKQAKTIGNRLVETYLGKVVEKPELRWMRALAYIVNI

Seg: seg
817-826 seg

IEESSISVVI

Seg: seg
935-945 seg

FLLIYLFLLIL


List of References

X Lin, S Kaul, S Rounsley, T P Shea, M I Benito, C D Town, C Y Fujii, T Mason, C L Bowman, M Barnstead, T V Feldblyum, C R Buell, K A Ketchum, J Lee, C M Ronning, H L Koo, K S Moffat, L A Cronin, M Shen, G Pai, S Van Aken, L Umayam, L J Tallon, J E Gill, M D Adams, A J Carrera, T H Creasy, H M Goodman, C R Somerville, G P Copenhaver, D Preuss, W C Nierman, O White, J A Eisen, S L Salzberg, C M Fraser, J C Venter
Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana.
Nature: 1999, 402(6763);761-8
PubMed:10617197 WorldCat.org DOI (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox