PRGDB00049104 (At2g25570)

From PRG Wiki
Jump to: navigation, search
At2g25570
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 20197744 (AC006300)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana chromosome 2 clone F13B15 map mi238, complete sequence.

DNA Sequence

ATGTTACTGTTGGGGCAGCTACATGGTTGCACAAGCTGCATTGAGAAAGAAAGGGAAGCTTTGTTAGAGCTCAAGAAATACTTGATGTCAAGGAGTCGAGAATCAGGGCTCGACTATGTTCTCCCTACTTGGACTAATGATACAAAGAGTGATTGCTGCCAGTGGGATGGCATTAAATGCAATCGTACAAGCGGGCGGGTTATCGAGCTTTCTGTTGGTGATATGTACTTCAAAGAGAGCTCTCCTTTAAATCTTTCTTTGCTCCATCCCTTTGAAGAAGTTCGAAGTCTGAACTTATCTACGGAAGGATACAACGAATTCAATGGCTTCTTTGATGACGTAGAAGGTTATAGAAGTTTAAGTGGATTACGAAACTTGAAGATCATGGATCTCTCAACGAATTATTTCAACTACAGCACATTTCCTTTTCTTAATGCCGCTACATCACTTACAACTCTTATTCTCACGTATAACGAAATGGATGGCCCTTTTCCTATCAAAGGACTAAAAGACTTGACAAACTTGGAACTGCTGGATTTGAGAGCAAACAAACTAAACGGCTCCATGCAAGAACTACAGAATTTGATTAACTTGGAAGTCTTGGGTCTTGCTCAGAATCATGTAGACGGACCTATACCAATAGAAGTATTCTGTAAACTGAAGAATCTGCGGGATCTCGATCTCAAAGGAAATCATTTTGTAGGTCAAATACCTCTTTGTTTAGGTAGCTTGAAGAAGCTACGGGTTCTTGATCTCTCATCCAACCAATTAAGTGGAGATCTACCATCTAGTTTCAGTAGTCTTGAGTCTCTCGAATATCTATCATTGTCGGATAACAATTTCGATGGCTCATTCTCACTCAATCCACTCACCAACCTTACAAACCTCAAGTTTGTTGTTGTACTACGGTTTTGCAGCTTGGAGAAAATCCCTTCCTTTCTCTTGTACCAGAAAAAATTGCGTCTAGTTGATCTATCCAGCAACAATTTATCTGGAAATATTCCTACGTGGCTGCTGACGAATAATCCAGAACTTGAAGTCCTACAGCTGCAGAATAATTCATTTACCATCTTTCCAATTCCTACAATGGTGCATAATTTGCAGATCTTTGATTTTTCAGCAAATAATATCGGGAAGTTCCCTGATAAGATGGACCATGCACTACCGAATCTGGTACGTTTAAATGGCTCGAATAATGGGTTCCAAGGTTATTTTCCAACGTCTATTGGTGAAATGAAGAATATTTCATTCTTGGACCTGTCTTATAATAACTTCTCTGGGAAGTTACCTAGAAGCTTTGTCACAGGTTGTGTTTCAATAATGTTCCTGAAGCTCTCTCACAACAAATTTAGCGGCCGTTTTCTTCCAAGAGAAACAAACTTCCCTTCACTTGACGTGTTGAGAATGGATAACAACTTGTTTACGGGGAACATCGGAGGTGGTTTGAGTAACTCCACTATGTTGCGGATTCTAGACATGTCCAACAATGGGCTCTCTGGTGCTATTCCAAGATGGTTATTTGAGTTTCCTTATTTGGATTACGTATTGATATCCAACAATTTCTTAGAAGGTACGATACCTCCTTCTTTGTTGGGAATGCCTTTTCTTTCGTTTCTAGACCTTTCTGGAAACCAATTTTCTGGAGCCTTACCGTCACATGTTGATAGCGAGCTCGGGATATATATGTTCCTACACAACAACAACTTCACAGGGCCAATTCCAGACACATTGTTGAAAAGTGTCCAGATACTTGATCTGCGGAACAATAAACTCTCTGGGAGTATCCCGCAGTTTGACGATACACAGAGCATAAACATTCTTTTGTTGAAGGGAAACAATTTAACAGGGTCTATTCCACGGGAGCTTTGTGATTTGAGCAACGTCAGACTTCTAGATCTTTCAGACAACAAGCTCAATGGTGTCATACCTTCATGCCTCTCTAATTTGTCATTTGGACGCTTACAAGAGGACGCAATGGCTCTCAATATTCCGCCCTCTTTCTTGCAAACAAGCCTTGAGATGGAATTATACAAATCAACTTTTTTGGTAGATAAGATTGAAGTGGACCGCTCTACTTATCAAGAAACTGAAATCAAATTTGCCGCAAAGCAAAGGTATGATTCTTATAGTGGAAGATCTGAGTTCAGCGAAGGAATTCTTCGTCTTATGTATGGGATGGATTTGTCAAACAATGAATTAAGTGGTGTTATCCCGACAGAGCTTGGAGATCTCTTGAAACTACGAACCTTGAATCTATCTCACAATTCCTTGTTGGGATCTATACCATCCAGCTTCTCCAAACTGATAGATGTTGAGAGCCTTGATCTTTCTCATAACATGTTGCAGGGAAGCATTCCTCAGCTACTCAGCAGCCTTACCTCTCTTGCTGTGTTCGACGTGTCTTCCAACAATTTATCAGGAATCATTCCCCAAGGAAGGCAGTTTAACACCTTTGAAGAGGAGAGCTACTTAGGAAATCCTCTGCTTTGTGGACCACCGACCAGTAGAAGTTGTGAGACTAATAAGAGTCCAGAGGAAGCAGATAATGGACAAGAAGAAGAAGACGATAAAGCTGCTATTGATATGATGGTTTTCTATTTTAGTACTGCTTCAATTTATGTGACCGCATTGATAGGCGTTCTTGTACTTATGTGCTTTGATTGTCCTTGGCGTCGAGCATGGCTCCGCATTGTGGATGCTTTCATCGCCTCAGCTAAACATGTGTTGCCTTAG


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Arabidopsis thaliana].

MLLLGQLHGCTSCIEKEREALLELKKYLMSRSRESGLDYVLPTWTNDTKSDCCQWDGIKCNRTSGRVIELSVGDMYFKESSPLNLSLLHPFEEVRSLNLSTEGYNEFNGFFDDVEGYRSLSGLRNLKIMDLSTNYFNYSTFPFLNAATSLTTLILTYNEMDGPFPIKGLKDLTNLELLDLRANKLNGSMQELQNLINLEVLGLAQNHVDGPIPIEVFCKLKNLRDLDLKGNHFVGQIPLCLGSLKKLRVLDLSSNQLSGDLPSSFSSLESLEYLSLSDNNFDGSFSLNPLTNLTNLKFVVVLRFCSLEKIPSFLLYQKKLRLVDLSSNNLSGNIPTWLLTNNPELEVLQLQNNSFTIFPIPTMVHNLQIFDFSANNIGKFPDKMDHALPNLVRLNGSNNGFQGYFPTSIGEMKNISFLDLSYNNFSGKLPRSFVTGCVSIMFLKLSHNKFSGRFLPRETNFPSLDVLRMDNNLFTGNIGGGLSNSTMLRILDMSNNGLSGAIPRWLFEFPYLDYVLISNNFLEGTIPPSLLGMPFLSFLDLSGNQFSGALPSHVDSELGIYMFLHNNNFTGPIPDTLLKSVQILDLRNNKLSGSIPQFDDTQSINILLLKGNNLTGSIPRELCDLSNVRLLDLSDNKLNGVIPSCLSNLSFGRLQEDAMALNIPPSFLQTSLEMELYKSTFLVDKIEVDRSTYQETEIKFAAKQRYDSYSGRSEFSEGILRLMYGMDLSNNELSGVIPTELGDLLKLRTLNLSHNSLLGSIPSSFSKLIDVESLDLSHNMLQGSIPQLLSSLTSLAVFDVSSNNLSGIIPQGRQFNTFEEESYLGNPLLCGPPTSRSCETNKSPEEADNGQEEEDDKAAIDMMVFYFSTASIYVTALIGVLVLMCFDCPWRRAWLRIVDAFIASAKHVLP


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-894 PTHR24420,FAMILY NOT NAMED

MLLLGQLHGCTSCIEKEREALLELKKYLMSRSRESGLDYVLPTWTNDTKSDCCQWDGIKCNRTSGRVIELSVGDMYFKESSPLNLSLLHPFEEVRSLNLSTEGYNEFNGFFDDVEGYRSLSGLRNLKIMDLSTNYFNYSTFPFLNAATSLTTLILTYNEMDGPFPIKGLKDLTNLELLDLRANKLNGSMQELQNLINLEVLGLAQNHVDGPIPIEVFCKLKNLRDLDLKGNHFVGQIPLCLGSLKKLRVLDLSSNQLSGDLPSSFSSLESLEYLSLSDNNFDGSFSLNPLTNLTNLKFVVVLRFCSLEKIPSFLLYQKKLRLVDLSSNNLSGNIPTWLLTNNPELEVLQLQNNSFTIFPIPTMVHNLQIFDFSANNIGKFPDKMDHALPNLVRLNGSNNGFQGYFPTSIGEMKNISFLDLSYNNFSGKLPRSFVTGCVSIMFLKLSHNKFSGRFLPRETNFPSLDVLRMDNNLFTGNIGGGLSNSTMLRILDMSNNGLSGAIPRWLFEFPYLDYVLISNNFLEGTIPPSLLGMPFLSFLDLSGNQFSGALPSHVDSELGIYMFLHNNNFTGPIPDTLLKSVQILDLRNNKLSGSIPQFDDTQSINILLLKGNNLTGSIPRELCDLSNVRLLDLSDNKLNGVIPSCLSNLSFGRLQEDAMALNIPPSFLQTSLEMELYKSTFLVDKIEVDRSTYQETEIKFAAKQRYDSYSGRSEFSEGILRLMYGMDLSNNELSGVIPTELGDLLKLRTLNLSHNSLLGSIPSSFSKLIDVESLDLSHNMLQGSIPQLLSSLTSLAVFDVSSNNLSGIIPQGRQFNTFEEESYLGNPLLCGPPTSRSCETNKSPEEADNGQEEEDDKAAIDMMVFYFSTASIYVTALIGVLVLMCFDCPWRRAW

HMMPanther: PTHR24420:SF914
1-894 PTHR24420:SF914

MLLLGQLHGCTSCIEKEREALLELKKYLMSRSRESGLDYVLPTWTNDTKSDCCQWDGIKCNRTSGRVIELSVGDMYFKESSPLNLSLLHPFEEVRSLNLSTEGYNEFNGFFDDVEGYRSLSGLRNLKIMDLSTNYFNYSTFPFLNAATSLTTLILTYNEMDGPFPIKGLKDLTNLELLDLRANKLNGSMQELQNLINLEVLGLAQNHVDGPIPIEVFCKLKNLRDLDLKGNHFVGQIPLCLGSLKKLRVLDLSSNQLSGDLPSSFSSLESLEYLSLSDNNFDGSFSLNPLTNLTNLKFVVVLRFCSLEKIPSFLLYQKKLRLVDLSSNNLSGNIPTWLLTNNPELEVLQLQNNSFTIFPIPTMVHNLQIFDFSANNIGKFPDKMDHALPNLVRLNGSNNGFQGYFPTSIGEMKNISFLDLSYNNFSGKLPRSFVTGCVSIMFLKLSHNKFSGRFLPRETNFPSLDVLRMDNNLFTGNIGGGLSNSTMLRILDMSNNGLSGAIPRWLFEFPYLDYVLISNNFLEGTIPPSLLGMPFLSFLDLSGNQFSGALPSHVDSELGIYMFLHNNNFTGPIPDTLLKSVQILDLRNNKLSGSIPQFDDTQSINILLLKGNNLTGSIPRELCDLSNVRLLDLSDNKLNGVIPSCLSNLSFGRLQEDAMALNIPPSFLQTSLEMELYKSTFLVDKIEVDRSTYQETEIKFAAKQRYDSYSGRSEFSEGILRLMYGMDLSNNELSGVIPTELGDLLKLRTLNLSHNSLLGSIPSSFSKLIDVESLDLSHNMLQGSIPQLLSSLTSLAVFDVSSNNLSGIIPQGRQFNTFEEESYLGNPLLCGPPTSRSCETNKSPEEADNGQEEEDDKAAIDMMVFYFSTASIYVTALIGVLVLMCFDCPWRRAW

superfamily: SSF52058
11-356 SSF52058,LRR

TSCIEKEREALLELKKYLMSRSRESGLDYVLPTWTNDTKSDCCQWDGIKCNRTSGRVIELSVGDMYFKESSPLNLSLLHPFEEVRSLNLSTEGYNEFNGFFDDVEGYRSLSGLRNLKIMDLSTNYFNYSTFPFLNAATSLTTLILTYNEMDGPFPIKGLKDLTNLELLDLRANKLNGSMQELQNLINLEVLGLAQNHVDGPIPIEVFCKLKNLRDLDLKGNHFVGQIPLCLGSLKKLRVLDLSSNQLSGDLPSSFSSLESLEYLSLSDNNFDGSFSLNPLTNLTNLKFVVVLRFCSLEKIPSFLLYQKKLRLVDLSSNNLSGNIPTWLLTNNPELEVLQLQNNSFT

Gene3D: G3DSA:3.80.10.10
15-294 G3DSA:3.80.10.10

EKEREALLELKKYLMSRSRESGLDYVLPTWTNDTKSDCCQWDGIKCNRTSGRVIELSVGDMYFKESSPLNLSLLHPFEEVRSLNLSTEGYNEFNGFFDDVEGYRSLSGLRNLKIMDLSTNYFNYSTFPFLNAATSLTTLILTYNEMDGPFPIKGLKDLTNLELLDLRANKLNGSMQELQNLINLEVLGLAQNHVDGPIPIEVFCKLKNLRDLDLKGNHFVGQIPLCLGSLKKLRVLDLSSNQLSGDLPSSFSSLESLEYLSLSDNNFDGSFSLNPLTNLT

HMMPfam: PF08263
IPR013210
16-61 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

KEREALLELKKYLMSRSRESGLDYVLPTWTNDTKSDCCQWDGIKCN

ProfileScan: PS51450
IPR001611
149-170 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTTLILTYNEMDGPFPIKGLK

ProfileScan: PS51450
IPR001611
174-196 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLELLDLRANKLNGSMQELQNLI

ProfileScan: PS51450
IPR001611
197-219 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEVLGLAQNHVDGPIPIEVFCK

ProfileScan: PS51450
IPR001611
222-245 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLRDLDLKGNHFVGQIPLCLGSLK

HMMPfam: PF13855
222-281 LRR_8,Leucine rich repeat

NLRDLDLKGNHFVGQIPLCLGSLKKLRVLDLSSNQLSGDLPSSFSSLESLEYLSLSDNNF

ProfileScan: PS51450
IPR001611
246-268 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLRVLDLSSNQLSGDLPSSFSSL

FPrintScan: PR00019
247-260 LEURICHRPT,Leucine-rich repeat signature

LRVLDLSSNQLSGD

ProfileScan: PS51450
IPR001611
270-291 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLEYLSLSDNNFDGSFSLNPLT

Gene3D: G3DSA:3.80.10.10
295-467 G3DSA:3.80.10.10

NLKFVVVLRFCSLEKIPSFLLYQKKLRLVDLSSNNLSGNIPTWLLTNNPELEVLQLQNNSFTIFPIPTMVHNLQIFDFSANNIGKFPDKMDHALPNLVRLNGSNNGFQGYFPTSIGEMKNISFLDLSYNNFSGKLPRSFVTGCVSIMFLKLSHNKFSGRFLPRETNFPSLDVL

HMMPfam: PF00560
IPR001611
319-340 LRR_1
Leucine-rich repeat

KLRLVDLSSNNLSGNIPTWLLT

ProfileScan: PS51450
IPR001611
319-341 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLRLVDLSSNNLSGNIPTWLLTN

ProfileScan: PS51450
IPR001611
344-364 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ELEVLQLQNNSFTIFPIPTMV

ProfileScan: PS51450
IPR001611
366-387 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQIFDFSANNIGKFPDKMDHA

superfamily: SSF52047
404-854 SSF52047,LRR

YFPTSIGEMKNISFLDLSYNNFSGKLPRSFVTGCVSIMFLKLSHNKFSGRFLPRETNFPSLDVLRMDNNLFTGNIGGGLSNSTMLRILDMSNNGLSGAIPRWLFEFPYLDYVLISNNFLEGTIPPSLLGMPFLSFLDLSGNQFSGALPSHVDSELGIYMFLHNNNFTGPIPDTLLKSVQILDLRNNKLSGSIPQFDDTQSINILLLKGNNLTGSIPRELCDLSNVRLLDLSDNKLNGVIPSCLSNLSFGRLQEDAMALNIPPSFLQTSLEMELYKSTFLVDKIEVDRSTYQETEIKFAAKQRYDSYSGRSEFSEGILRLMYGMDLSNNELSGVIPTELGDLLKLRTLNLSHNSLLGSIPSSFSKLIDVESLDLSHNMLQGSIPQLLSSLTSLAVFDVSSNNLSGIIPQGRQFNTFEEESYLGNPLLCGPPTSRSCETNKSPEEADNGQEEE

ProfileScan: PS51450
IPR001611
414-436 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NISFLDLSYNNFSGKLPRSFVTG

HMMPfam: PF00560
IPR001611
414-433 LRR_1
Leucine-rich repeat

NISFLDLSYNNFSGKLPRSF

Gene3D: G3DSA:3.80.10.10
468-569 G3DSA:3.80.10.10

RMDNNLFTGNIGGGLSNSTMLRILDMSNNGLSGAIPRWLFEFPYLDYVLISNNFLEGTIPPSLLGMPFLSFLDLSGNQFSGALPSHVDSELGIYMFLHNNNF

ProfileScan: PS51450
IPR001611
487-509 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

MLRILDMSNNGLSGAIPRWLFEF

HMMPfam: PF00560
IPR001611
488-507 LRR_1
Leucine-rich repeat

LRILDMSNNGLSGAIPRWLF

ProfileScan: PS51450
IPR001611
535-557 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FLSFLDLSGNQFSGALPSHVDSE

Gene3D: G3DSA:3.80.10.10
570-656 G3DSA:3.80.10.10

TGPIPDTLLKSVQILDLRNNKLSGSIPQFDDTQSINILLLKGNNLTGSIPRELCDLSNVRLLDLSDNKLNGVIPSCLSNLSFGRLQE

ProfileScan: PS51450
IPR001611
580-602 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SVQILDLRNNKLSGSIPQFDDTQ

HMMPfam: PF00560
IPR001611
581-598 LRR_1
Leucine-rich repeat

VQILDLRNNKLSGSIPQF

ProfileScan: PS51450
IPR001611
603-626 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SINILLLKGNNLTGSIPRELCDLS

ProfileScan: PS51450
IPR001611
627-650 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NVRLLDLSDNKLNGVIPSCLSNLS

Gene3D: G3DSA:3.80.10.10
726-834 G3DSA:3.80.10.10

MDLSNNELSGVIPTELGDLLKLRTLNLSHNSLLGSIPSSFSKLIDVESLDLSHNMLQGSIPQLLSSLTSLAVFDVSSNNLSGIIPQGRQFNTFEEESYLGNPLLCGPPT

HMMPfam: PF13855
727-781 LRR_8,Leucine rich repeat

DLSNNELSGVIPTELGDLLKLRTLNLSHNSLLGSIPSSFSKLIDVESLDLSHNML

FPrintScan: PR00019
744-757 LEURICHRPT,Leucine-rich repeat signature

LLKLRTLNLSHNSL

ProfileScan: PS51450
IPR001611
746-768 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLRTLNLSHNSLLGSIPSSFSKL

ProfileScan: PS51450
IPR001611
770-792 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

DVESLDLSHNMLQGSIPQLLSSL

ProfileScan: PS51450
IPR001611
794-815 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLAVFDVSSNNLSGIIPQGRQF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox