PRGDB00049105 (At2g24280)

From PRG Wiki
Jump to: navigation, search
At2g24280
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 20197494 (AC005967)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana chromosome 2 clone F27D4 map CIC06C07, complete sequence.

DNA Sequence

GTTGCTTATTGAGATTGTCATCGCTAGAACTTTCTCACAACTCTTTGAGTGGTTTTGGAAAATCATCACAAGTTCTAGATCAAGCACAAATGCGAGTTTGCGTCTTGATTCTAATTCATTCCAAGGACCATTTCCACATTGGATCTGCCAGTTTAGATTGCTGGAGATTTTAGATTTGTCCAACAATAGCTTCAGTGGCTCAATTCCTCTATGTTTAAGGAATATCACTTATTCTTTGGAAGTGCTTAATCTACGAAACAACAATTTCAGTGGGATTCTTCCAGATGTGTTTCTCAATGCTACTCGTTTATACACACTTGATGTTACCCGCAACCGGTTGGAAGGTAAACTCCCAAAAACCTTGATCAATTGCACATCCATGCGACTTTTGAATGTGGAAGGAAACAAATTCAAGGAGACGTTTCCATCTTGGTTGGGTTCTATGCCATATTTAGATATCCTCATCCTCCGAGCCAACCAATTCTATGGGCCGTTATATCACCTCCACGAATCTACTTGGTTTCAACATTTAAAGGTTATTGATGTCTCACATAATGACTTCACTGGATCCTTCCCAGCTTTCTATTTTTCCAACTGGCTTCAAATGACTACATTACACCTAGAAATTGATGTTGTATACTTCGAATATCCTACCATCCAAGATGATTATGATGACCCTTATTTTGGTACTTACACTAGTTCAATGGAAATAGTGAACAAAGGTGTGGATAGAGAGTTTGATAAGATCAGGCAAGACTTCACATCCATTGATTTTTCAAGCAACAAGTTTTATGGAAAGATCCCTGAATCCATTGGCTTGTTGAAGGGATTACGTTTTCTCAACTTGTCGGGTAATGCTTTCACAAGCGATATACCTCAATCATTGGCAAATTTGACGAATCTCGAGGCATTAGATTTGTCTCATAATCAGCTGTCAGGTCAGATTCCCCGAGATCTTGGTGAGCTCTCCTTTCTGTCAACCATGAACTTCGCCCACAACAATCTCGAAGGTCCAATACCACGCGGAACACAATTTCAACGCCAAAACTGTTCTTCATTCATGGACAACCCCAAGCTTTATGGTCTCGATGATATCTGCAGAAAAACTCATGTCCCAAATCCTAGACCACAAGAATTAGAGAAAGTATCAGAGCCGGAAGAAGAGCAAGTGATTAACTGGACATCAGCAGCAATAGCGTATGGACCTGGTGTGTTTTGCGGATTAGTGATTGGACATATCTTCATTTCGCATAAGCAGGAGTGGTTAATGGAAAAGTGTCGTAGAAACAAGCCCAGAGTTGTCATCAGAAGCGCTCGTTGAATGAACTTCCGGAGACTTGAAAATATGAGGTCATGGAACAAGAGCAGTGATTGCTGTTCTTGGGAGTCTGTCACGTGTGATGCTAAATATGGCCAGGTGATTTCACTTTATCTTCTTGGCGTTAATCTTAACAACACTTTAAAACCAAATAGTGGTCTTTTCAAACTCCAATATCTCCAAAACCTAACCCTTCGTTATTGCAATCTCTATGGAGAGATTCCTTTTTCATTAGGAACCCTTTCTCATCTCACCTTTCTCGACCTTTCGGAAAATAAATTAGTTGGTCAAGTTCCATCTTCAATTGGAAACTTGACCAAACTAATGTACCTTCGCCTTTCCATAAACCACTTAAGTGGCAAATCTTCTGTTTCATTTGCCAATTTAACGAAATTGATCCAACTCGACATCAGAGAAAATGACTTTGAACCCGAGCTTATACCGGACATGAGCCGATTCCACAACTTGGAGGGATTTGGGGGTGGGAACTTTTTCGGGCCTTTTCCTACATCCTTGTTCACGATTCCTTCGTTACGATGGGTTAATTTGAGGGACAGTAACAACAACTTCACGGGACATATAGATTTTGGGAATTCGTCTTTATCTTCTAGGCTTTCTTATCTTAGTCTTGCTGATAACAATTTCGATGGCCCAATCCCTGAATCCATATCTAAATTTCTCAATCTCGTATTATTAGATCTTCGTAACAACTCATTTTCCGGGCCTTTCCCAACATCCTTGTTCAAGATTCCTTCGTTACAATGGGTTACTTTGGCGCGAAACAATTTCAAGGGACCTATAGATTTTGGGAATACATGGCCATCATCGTCTAGTCTTAGTAGTCTATACCTTGCTGATAACAATTTCGATGGCCAAATCCCAGAATCCATATCTCAATTTCTCAAACTCGAAAG


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Arabidopsis thaliana].

MNFRRLENMRSWNKSSDCCSWESVTCDAKYGQVISLYLLGVNLNNTLKPNSGLFKLQYLQNLTLRYCNLYGEIPFSLGTLSHLTFLDLSENKLVGQVPSSIGNLTKLMYLRLSINHLSGKSSVSFANLTKLIQLDIRENDFEPELIPDMSRFHNLEGFGGGNFFGPFPTSLFTIPSLRWVNLRDSNNNFTGHIDFGNSSLSSRLSYLSLADNNFDGPIPESISKFLNLVLLDLRNNSFSGPFPTSLFKIPSLQWVTLARNNFKGPIDFGNTWPSSSSLSSLYLADNNFDGQIPESISQFLKLERLLIEIVIARTFSQLFEWFWKIITSSRSSTNASLRLDSNSFQGPFPHWICQFRLLEILDLSNNSFSGSIPLCLRNITYSLEVLNLRNNNFSGILPDVFLNATRLYTLDVTRNRLEGKLPKTLINCTSMRLLNVEGNKFKETFPSWLGSMPYLDILILRANQFYGPLYHLHESTWFQHLKVIDVSHNDFTGSFPAFYFSNWLQMTTLHLEIDVVYFEYPTIQDDYDDPYFGTYTSSMEIVNKGVDREFDKIRQDFTSIDFSSNKFYGKIPESIGLLKGLRFLNLSGNAFTSDIPQSLANLTNLEALDLSHNQLSGQIPRDLGELSFLSTMNFAHNNLEGPIPRGTQFQRQNCSSFMDNPKLYGLDDICRKTHVPNPRPQELEKVSEPEEEQVINWTSAAIAYGPGVFCGLVIGHIFISHKQEWLMEKCRRNKPRVVIRSAR


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF913
7-727 PTHR24420:SF913

ENMRSWNKSSDCCSWESVTCDAKYGQVISLYLLGVNLNNTLKPNSGLFKLQYLQNLTLRYCNLYGEIPFSLGTLSHLTFLDLSENKLVGQVPSSIGNLTKLMYLRLSINHLSGKSSVSFANLTKLIQLDIRENDFEPELIPDMSRFHNLEGFGGGNFFGPFPTSLFTIPSLRWVNLRDSNNNFTGHIDFGNSSLSSRLSYLSLADNNFDGPIPESISKFLNLVLLDLRNNSFSGPFPTSLFKIPSLQWVTLARNNFKGPIDFGNTWPSSSSLSSLYLADNNFDGQIPESISQFLKLERLLIEIVIARTFSQLFEWFWKIITSSRSSTNASLRLDSNSFQGPFPHWICQFRLLEILDLSNNSFSGSIPLCLRNITYSLEVLNLRNNNFSGILPDVFLNATRLYTLDVTRNRLEGKLPKTLINCTSMRLLNVEGNKFKETFPSWLGSMPYLDILILRANQFYGPLYHLHESTWFQHLKVIDVSHNDFTGSFPAFYFSNWLQMTTLHLEIDVVYFEYPTIQDDYDDPYFGTYTSSMEIVNKGVDREFDKIRQDFTSIDFSSNKFYGKIPESIGLLKGLRFLNLSGNAFTSDIPQSLANLTNLEALDLSHNQLSGQIPRDLGELSFLSTMNFAHNNLEGPIPRGTQFQRQNCSSFMDNPKLYGLDDICRKTHVPNPRPQELEKVSEPEEEQVINWTSAAIAYGPGVFCGLVIGHIFISHKQEWLM

HMMPanther: PTHR24420
7-727 PTHR24420,FAMILY NOT NAMED

ENMRSWNKSSDCCSWESVTCDAKYGQVISLYLLGVNLNNTLKPNSGLFKLQYLQNLTLRYCNLYGEIPFSLGTLSHLTFLDLSENKLVGQVPSSIGNLTKLMYLRLSINHLSGKSSVSFANLTKLIQLDIRENDFEPELIPDMSRFHNLEGFGGGNFFGPFPTSLFTIPSLRWVNLRDSNNNFTGHIDFGNSSLSSRLSYLSLADNNFDGPIPESISKFLNLVLLDLRNNSFSGPFPTSLFKIPSLQWVTLARNNFKGPIDFGNTWPSSSSLSSLYLADNNFDGQIPESISQFLKLERLLIEIVIARTFSQLFEWFWKIITSSRSSTNASLRLDSNSFQGPFPHWICQFRLLEILDLSNNSFSGSIPLCLRNITYSLEVLNLRNNNFSGILPDVFLNATRLYTLDVTRNRLEGKLPKTLINCTSMRLLNVEGNKFKETFPSWLGSMPYLDILILRANQFYGPLYHLHESTWFQHLKVIDVSHNDFTGSFPAFYFSNWLQMTTLHLEIDVVYFEYPTIQDDYDDPYFGTYTSSMEIVNKGVDREFDKIRQDFTSIDFSSNKFYGKIPESIGLLKGLRFLNLSGNAFTSDIPQSLANLTNLEALDLSHNQLSGQIPRDLGELSFLSTMNFAHNNLEGPIPRGTQFQRQNCSSFMDNPKLYGLDDICRKTHVPNPRPQELEKVSEPEEEQVINWTSAAIAYGPGVFCGLVIGHIFISHKQEWLM

Gene3D: G3DSA:3.80.10.10
8-174 G3DSA:3.80.10.10

NMRSWNKSSDCCSWESVTCDAKYGQVISLYLLGVNLNNTLKPNSGLFKLQYLQNLTLRYCNLYGEIPFSLGTLSHLTFLDLSENKLVGQVPSSIGNLTKLMYLRLSINHLSGKSSVSFANLTKLIQLDIRENDFEPELIPDMSRFHNLEGFGGGNFFGPFPTSLFTI

HMMPfam: PF08263
IPR013210
8-27 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

NMRSWNKSSDCCSWESVTCD

superfamily: SSF52058
17-308 SSF52058,LRR

DCCSWESVTCDAKYGQVISLYLLGVNLNNTLKPNSGLFKLQYLQNLTLRYCNLYGEIPFSLGTLSHLTFLDLSENKLVGQVPSSIGNLTKLMYLRLSINHLSGKSSVSFANLTKLIQLDIRENDFEPELIPDMSRFHNLEGFGGGNFFGPFPTSLFTIPSLRWVNLRDSNNNFTGHIDFGNSSLSSRLSYLSLADNNFDGPIPESISKFLNLVLLDLRNNSFSGPFPTSLFKIPSLQWVTLARNNFKGPIDFGNTWPSSSSLSSLYLADNNFDGQIPESISQFLKLERLLIE

HMMPfam: PF13855
81-140 LRR_8,Leucine rich repeat

SHLTFLDLSENKLVGQVPSSIGNLTKLMYLRLSINHLSGKSSVSFANLTKLIQLDIREND

ProfileScan: PS51450
IPR001611
82-108 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLTFLDLSENKLVGQVPSSIGNLTKLM

FPrintScan: PR00019
83-96 LEURICHRPT,Leucine-rich repeat signature

LTFLDLSENKLVGQ

Gene3D: G3DSA:3.80.10.10
175-305 G3DSA:3.80.10.10

PSLRWVNLRDSNNNFTGHIDFGNSSLSSRLSYLSLADNNFDGPIPESISKFLNLVLLDLRNNSFSGPFPTSLFKIPSLQWVTLARNNFKGPIDFGNTWPSSSSLSSLYLADNNFDGQIPESISQFLKLERL

ProfileScan: PS51450
IPR001611
227-248 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLVLLDLRNNSFSGPFPTSLFK

ProfileScan: PS51450
IPR001611
277-299 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLSSLYLADNNFDGQIPESISQF

Gene3D: G3DSA:3.80.10.10
336-512 G3DSA:3.80.10.10

SLRLDSNSFQGPFPHWICQFRLLEILDLSNNSFSGSIPLCLRNITYSLEVLNLRNNNFSGILPDVFLNATRLYTLDVTRNRLEGKLPKTLINCTSMRLLNVEGNKFKETFPSWLGSMPYLDILILRANQFYGPLYHLHESTWFQHLKVIDVSHNDFTGSFPAFYFSNWLQMTTLHLE

superfamily: SSF52058
336-672 SSF52058,LRR

SLRLDSNSFQGPFPHWICQFRLLEILDLSNNSFSGSIPLCLRNITYSLEVLNLRNNNFSGILPDVFLNATRLYTLDVTRNRLEGKLPKTLINCTSMRLLNVEGNKFKETFPSWLGSMPYLDILILRANQFYGPLYHLHESTWFQHLKVIDVSHNDFTGSFPAFYFSNWLQMTTLHLEIDVVYFEYPTIQDDYDDPYFGTYTSSMEIVNKGVDREFDKIRQDFTSIDFSSNKFYGKIPESIGLLKGLRFLNLSGNAFTSDIPQSLANLTNLEALDLSHNQLSGQIPRDLGELSFLSTMNFAHNNLEGPIPRGTQFQRQNCSSFMDNPKLYGLDDICRK

ProfileScan: PS51450
IPR001611
357-378 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

LLEILDLSNNSFSGSIPLCLRN

HMMPfam: PF00560
IPR001611
358-376 LRR_1
Leucine-rich repeat

LEILDLSNNSFSGSIPLCL

HMMPfam: PF00560
IPR001611
382-401 LRR_1
Leucine-rich repeat

SLEVLNLRNNNFSGILPDVF

ProfileScan: PS51450
IPR001611
382-403 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLEVLNLRNNNFSGILPDVFLN

ProfileScan: PS51450
IPR001611
480-502 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLKVIDVSHNDFTGSFPAFYFSN

Gene3D: G3DSA:3.80.10.10
556-664 G3DSA:3.80.10.10

DFTSIDFSSNKFYGKIPESIGLLKGLRFLNLSGNAFTSDIPQSLANLTNLEALDLSHNQLSGQIPRDLGELSFLSTMNFAHNNLEGPIPRGTQFQRQNCSSFMDNPKLY

HMMPfam: PF12799
580-616 LRR_4,Leucine Rich repeats (2 copies)

GLRFLNLSGNAFTSDIPQSLANLTNLEALDLSHNQLS

ProfileScan: PS51450
IPR001611
580-603 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

GLRFLNLSGNAFTSDIPQSLANLT

FPrintScan: PR00019
602-615 LEURICHRPT,Leucine-rich repeat signature

LTNLEALDLSHNQL

ProfileScan: PS51450
IPR001611
604-627 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEALDLSHNQLSGQIPRDLGELS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox