PRGDB00049121 (putative Cf2/Cf5 disease resistance protein)

From PRG Wiki
Jump to: navigation, search
putative Cf2/Cf5 disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 38174808 (AJ495770)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase
Gene Species Hordeum vulgare subsp. vulgare

Comment?

Hordeum vulgare partial mRNA for putative Cf2/Cf5 disease resistance protein.

DNA Sequence

TCTATTGATCTCCCAAGCAACATCCACTTCCCATGGCCAAGCGAGTGTGTCAGGAGCCTGCATCAGCAGCGAGCGAGACGCACTTCTGTCCTTCAAGGCAAGCCTCCTGGACCCTGCTGGCCATCTCTCGTCATGGCAGGGTGAGGATTGTTGCCAATGGAAGGGAGTCCGCTGTAGCAACAGAACGGGCCATCTCATCAAGCTCAACCTCCGCAACGTCGACATGCGTGACTACGGGTACGCAACCATCTCATCAAGCCGCCCGAACAGCAGCAGATCAGTGAGCTTGTCGGTAGGTCAGATGAGCTCTTCTTTGGCTACTTTACAACACCTGAGATATCTTGATCTGAGTTGGAATGACTTCAAGGGCACAAGCATCCCTGTCTTTTTGGCTTCTCTCAAGAACCTAAGGTACCTCAACCTATCGTCGGCAGGATTCAGTGGGAGAATTCCTTCCCAACTTGGCAATCTCTCAAAGTTGCAATATCTTGATCTCAGTTGGAATTCTAATTATGTTGATTGGAATTGGAATAGGTTTTACATAGTGGATCTTGCATGGTTGCCACGTCTCTCTTTGTTGAGACATCTTGACATGAGTTATGTGGATCTTGGTTCTGCGAAAAAAAAAAAAAAAAAAAAAAAAAAAAA


Protein sequences

Name Description Sequence
putative Cf2/Cf5 disease resistance protein putative Cf2/Cf5 disease resistance protein [Hordeum vulgare subsp. vulgare].

LLISQATSTSHGQASVSGACISSERDALLSFKASLLDPAGHLSSWQGEDCCQWKGVRCSNRTGHLIKLNLRNVDMRDYGYATISSSRPNSSRSVSLSVGQMSSSLATLQHLRYLDLSWNDFKGTSIPVFLASLKNLRYLNLSSAGFSGRIPSQLGNLSKLQYLDLSWNSNYVDWNWNRFYIVDLAWLPRLSLLRHLDMSYVDLGSAKKKKKKKKK

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
13-169 PTHR24420,FAMILY NOT NAMED

QASVSGACISSERDALLSFKASLLDPAGHLSSWQGEDCCQWKGVRCSNRTGHLIKLNLRNVDMRDYGYATISSSRPNSSRSVSLSVGQMSSSLATLQHLRYLDLSWNDFKGTSIPVFLASLKNLRYLNLSSAGFSGRIPSQLGNLSKLQYLDLSWNS

superfamily: SSF52058
18-206 SSF52058,LRR

GACISSERDALLSFKASLLDPAGHLSSWQGEDCCQWKGVRCSNRTGHLIKLNLRNVDMRDYGYATISSSRPNSSRSVSLSVGQMSSSLATLQHLRYLDLSWNDFKGTSIPVFLASLKNLRYLNLSSAGFSGRIPSQLGNLSKLQYLDLSWNSNYVDWNWNRFYIVDLAWLPRLSLLRHLDMSYVDLGSA

Gene3D: G3DSA:3.80.10.10
20-203 G3DSA:3.80.10.10

CISSERDALLSFKASLLDPAGHLSSWQGEDCCQWKGVRCSNRTGHLIKLNLRNVDMRDYGYATISSSRPNSSRSVSLSVGQMSSSLATLQHLRYLDLSWNDFKGTSIPVFLASLKNLRYLNLSSAGFSGRIPSQLGNLSKLQYLDLSWNSNYVDWNWNRFYIVDLAWLPRLSLLRHLDMSYVDL

HMMPfam: PF08263
IPR013210
22-59 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

SSERDALLSFKASLLDPAGHLSSWQGEDCCQWKGVRCS

HMMPfam: PF12799
110-146 LRR_4,Leucine Rich repeats (2 copies)

HLRYLDLSWNDFKGTSIPVFLASLKNLRYLNLSSAGF

HMMPfam: PF13504
159-169 LRR_7,Leucine rich repeat

KLQYLDLSWNS






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox