PRGDB00049123 (putative disease resistance protein)

From PRG Wiki
Jump to: navigation, search
putative disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 33772102 (AY347778)
Gene Class Unknown
Domain Type LRR
Gene Species Malus x domestica

Comment?

Malus x domestica clone 16-3 putative disease resistance protein mRNA, partial cds.

DNA Sequence

AGATCTGCCTCGGATCTTGATGACGCTTATCCAAAGACTTCGCAATGGAAACTAGTTGAAGGACGAAATGGCAACTGCTGTGCATGGGATGGCATTGTGTGTGACGGGAGGACGGGTCATGTGATTGGCCTTGATCTGAGTAGCAGCTGTCTCCTGGGCTCTATCAACTCCAACAGCAGCCTTTTCCAGCTTGTTCAGCTTCAAGCGCTAAACCTCGCTGACAACAACTTCAACTACTCT


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Malus x domestica].

RSASDLDDAYPKTSQWKLVEGRNGNCCAWDGIVCDGRTGHVIGLDLSSSCLLGSINSNSSLFQLVQLQALNLADNNFNYS

Domains

Domain Start-End Description Sequence

HMMPfam: PF08263
IPR013210
6-35 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

LDDAYPKTSQWKLVEGRNGNCCAWDGIVCD

Gene3D: G3DSA:3.80.10.10
13-78 G3DSA:3.80.10.10

TSQWKLVEGRNGNCCAWDGIVCDGRTGHVIGLDLSSSCLLGSINSNSSLFQLVQLQALNLADNNFN






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox