PRGDB00049136 (At2g19780)

From PRG Wiki
Jump to: navigation, search
At2g19780
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 28393469 (BT004135)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana clone RAFL15-20-F01 (R20712) putative disease resistance protein (At2g19780) mRNA, complete cds.

DNA Sequence

ATGAAGAAGAAAGGCACCAACAACAACAACTTTAGCCTTCTGTCTTTGTCTCTGTTCCTGAATTGTTTGATTCTAACAAACGGATACAGCATTGGAGTCGGAGTTGGAATCGGCGGTGGAGACGGTGACGACGGCGGAGTTTGGATAGGTGGAGGAAACCCTAATTCCAATCCTGGCTCAGCTCCAAACCAACAACAGACAACAAATGCAGCTTACAATGCTCTTCAATCTTGGAAATCCGCCATTACAGAGGATCCATCTGGTGTTCTTAAAACATGGGTTGGTGAAGATGTTTGTTCTTACAGAGGCGTGTTCTGTTCTGGCTCATCTATAACCTCCATAGATCTAAACAAAGCAAATCTCAAAGGCACCATTGTTAAAGACCTCTCTTTACTCTCAGACCTAACCATTCTTCATCTCAACAGTAACAGATTCTCTGGTCAAATCCCAGATTCTTTCAAGAATCTTGATTCTCTTCAAGAACTCGATCTCAGCAACAACAGATTCTCCGGTTCTTTCCCTCAAGTCACACTCTACATCCCAAATCTGGTTTACCTCGATCTCCGGTTCAACAATTTCACTGGCTCTATACCGGAAAATCTCTTCAACAAACAATTAGACGCGATTCTCCTCAACAACAATCAATTCACCGGAGAAATCCCTGGGAATCTCGGTTACTCTACAGCTTCGGTGATTAATCTCGCTAACAACAAATTATCCGGCGAAATCCCGACGAGTTTCGGTATCACCGGTTCGAAATTGAAAGAGGTTTTGTTCTTGAATAACCAGTTAACCGGTTGTATACCGGAATCAGTTGGTTTATTCTCCGACATTGAAGTGTTTGATGTTAGTTTCAATTCATTGATGGGTCATGTCCCTGACACGATCTCTTGCTTATCGGAGATTGAAGTTTTGAATCTCGGACACAACAAATTCTCCGGTGATCTTCCTGATTTGGTCTGTACTTTGAGGAATCTGATAAATCTGACGGTTTCTTTCAACTTCTTCTCTGGGTTTAGCTCTCAGTGCTCGAGCCTTAGCGTTGGGTTTGATTTCACCGGAAATTGTATTCCCGGTAAGGGTTATCAACGGCCTCAGCCGGATTGTTCGGCGATTCCTGGTGGCCAATTGAGCTGTTTTAGAATTCCGGCGCAGCCGTTAACGTGTGCTGCGATTAGCTTGGGGTTGAAGGTGGCTTCATCTCCATGA


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Arabidopsis thaliana].

MKKKGTNNNNFSLLSLSLFLNCLILTNGYSIGVGVGIGGGDGDDGGVWIGGGNPNSNPGSAPNQQQTTNAAYNALQSWKSAITEDPSGVLKTWVGEDVCSYRGVFCSGSSITSIDLNKANLKGTIVKDLSLLSDLTILHLNSNRFSGQIPDSFKNLDSLQELDLSNNRFSGSFPQVTLYIPNLVYLDLRFNNFTGSIPENLFNKQLDAILLNNNQFTGEIPGNLGYSTASVINLANNKLSGEIPTSFGITGSKLKEVLFLNNQLTGCIPESVGLFSDIEVFDVSFNSLMGHVPDTISCLSEIEVLNLGHNKFSGDLPDLVCTLRNLINLTVSFNFFSGFSSQCSSLSVGFDFTGNCIPGKGYQRPQPDCSAIPGGQLSCFRIPAQPLTCAAISLGLKVASSP

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR26393:SF462
43-373 PTHR26393:SF462

DDGGVWIGGGNPNSNPGSAPNQQQTTNAAYNALQSWKSAITEDPSGVLKTWVGEDVCSYRGVFCSGSSITSIDLNKANLKGTIVKDLSLLSDLTILHLNSNRFSGQIPDSFKNLDSLQELDLSNNRFSGSFPQVTLYIPNLVYLDLRFNNFTGSIPENLFNKQLDAILLNNNQFTGEIPGNLGYSTASVINLANNKLSGEIPTSFGITGSKLKEVLFLNNQLTGCIPESVGLFSDIEVFDVSFNSLMGHVPDTISCLSEIEVLNLGHNKFSGDLPDLVCTLRNLINLTVSFNFFSGFSSQCSSLSVGFDFTGNCIPGKGYQRPQPDCSAIP

HMMPanther: PTHR26393
43-373 PTHR26393,FAMILY NOT NAMED

DDGGVWIGGGNPNSNPGSAPNQQQTTNAAYNALQSWKSAITEDPSGVLKTWVGEDVCSYRGVFCSGSSITSIDLNKANLKGTIVKDLSLLSDLTILHLNSNRFSGQIPDSFKNLDSLQELDLSNNRFSGSFPQVTLYIPNLVYLDLRFNNFTGSIPENLFNKQLDAILLNNNQFTGEIPGNLGYSTASVINLANNKLSGEIPTSFGITGSKLKEVLFLNNQLTGCIPESVGLFSDIEVFDVSFNSLMGHVPDTISCLSEIEVLNLGHNKFSGDLPDLVCTLRNLINLTVSFNFFSGFSSQCSSLSVGFDFTGNCIPGKGYQRPQPDCSAIP

superfamily: SSF52058
65-346 SSF52058,LRR

QQTTNAAYNALQSWKSAITEDPSGVLKTWVGEDVCSYRGVFCSGSSITSIDLNKANLKGTIVKDLSLLSDLTILHLNSNRFSGQIPDSFKNLDSLQELDLSNNRFSGSFPQVTLYIPNLVYLDLRFNNFTGSIPENLFNKQLDAILLNNNQFTGEIPGNLGYSTASVINLANNKLSGEIPTSFGITGSKLKEVLFLNNQLTGCIPESVGLFSDIEVFDVSFNSLMGHVPDTISCLSEIEVLNLGHNKFSGDLPDLVCTLRNLINLTVSFNFFSGFSSQCSSL

Gene3D: G3DSA:3.80.10.10
67-347 G3DSA:3.80.10.10

TTNAAYNALQSWKSAITEDPSGVLKTWVGEDVCSYRGVFCSGSSITSIDLNKANLKGTIVKDLSLLSDLTILHLNSNRFSGQIPDSFKNLDSLQELDLSNNRFSGSFPQVTLYIPNLVYLDLRFNNFTGSIPENLFNKQLDAILLNNNQFTGEIPGNLGYSTASVINLANNKLSGEIPTSFGITGSKLKEVLFLNNQLTGCIPESVGLFSDIEVFDVSFNSLMGHVPDTISCLSEIEVLNLGHNKFSGDLPDLVCTLRNLINLTVSFNFFSGFSSQCSSLS

HMMPfam: PF08263
IPR013210
73-107 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

NALQSWKSAITEDPSGVLKTWVGEDVCSYRGVFCS

HMMPfam: PF13855
135-193 LRR_8,Leucine rich repeat

LTILHLNSNRFSGQIPDSFKNLDSLQELDLSNNRFSGSFPQVTLYIPNLVYLDLRFNNF






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox