PRGDB00049138 (At2g33050)

From PRG Wiki
Jump to: navigation, search
At2g33050
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 26983813 (BT002326)
Gene Class Unknown
Domain Type LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana clone C104972 putative leucine-rich repeat disease resistance protein (At2g33050) mRNA, complete cds.

DNA Sequence

ATGCGTTTGCATTTTTGCTCGCTACTCTTACTCTACTGTATCGTCTTCGTTTCAAGCTTCTTGACGACCGACGCTCTTGCTTGTCTTCCTGACCAGATCCAAGCTCTAATCCAATTCAAGAATGAGTTTGAATCTGACGGCTGCAACCGCAGTGACTACTTAAACGGAGTCCAGTGTGATAACACGACTGGTGCGGTCACGAAGCTTCAGCTCCCAAGTGGTTGCTTCACTGGAACTCTCAAACCAAACAGTAGTCTCTTTGAGTTGCATCAGCTTCGTTACCTTAATCTCTCTCACAACAACTTCACTTCCTCTTCACTCCCTTCTGAATTCAGCAATCTCACCAGATTAGAGGTTTTGTCTCTTGCCTCTAGTAGCTTTACTGGTCAAGTTCCTTCCTCAATTAGTAACCTTATCTTGCTTACCCATTTAAACCTTTCCCATAATGAGCTCACTGGTAGTTTCCCACCTGTAAGAAACCTAACAAAGCTTTCCTTTTTAGACCTTTCTTACAATCAATTCTCAGGAGCCATACCTTTTGATTTACTACCCACTTTGCCTTTCTTGTCTTATCTTGATCTGAAAAAGAATCATCTCACTGGTTCTATTGATGTCCCAAACTCTTCTTCTTCATCTAAGCTAGTTCGTTTGTCCCTTGGGTTTAACCAATTTGAAGGAAAAATCATAGAGCCTATCTCAAAGCTCATAAACCTCAACCATCTTGAACTTGCTTCCCTAAACATAAGTCACCCAATTGACTTACGCGTCTTCGCTCCTCTCAAATCTTTGTTGGTCTTTGATATTCGTCAAAATAGGTTATTACCAGCCAGTTTAAGTTCAGATTCAGAGTTTCCATTGAGCTTAATAAGCTTGATTTTGATCCAGTGCGACATTATCGAGTTTCCAAACATCTTTAAGACCCTTCAAAACTTGGAGCATATAGACATTTCCAACAATCTAATCAAAGGGAAAGTACCTGAGTGGTTTTGGAAGCTTCCTCGTCTTAGCATAGCAAATCTTGTTAACAATTCTTTGACTGGTTTCGAAGGTTCTTCAGAAGTTTTACTTAACTCATCAGTGCAGTTACTAGATTTTGCCTATAACTCCATGACAGGAGCGTTTCCTACTCCACCACTCGGTTCGATCTACTTGTCTGCGTGGAACAATAGTTTCACAGGGAACATACCTCTCTCAATCTGCAACCGAAGCTCTCTCATCGTCCTTGATCTATCCTACAACAAATTCACCGGTCCAATTCCTCAATGTCTGAGTAACTTAAAAGTAGTAAACCTCAGGAAGAACAGCTTGGAAGGAAGTATACCTGACGAGTTCCATAGCGGTGCTAAGACACAGACGCTTGACGTTGGCTATAATCGACTAACCGGGAAGCTTCCAAAATCACTTTTGAATTGCTCCTCTCTGAGGTTTCTGAGTGTTGACAACAACAGAATTGAAGACACGTTTCCTTTCTGGCTGAAGGCGCTACCCAATTTGCATGTCTTGACTCTCCGTTCAAACAGATTCTTCGGCCATCTCTCTCCTCCTGATCGAGGTCCTCTCGCGTTTCCCGAGCTGCGGATACTTGAATTGTCAGATAACAGCTTTACTGGAAGCTTGCCACCAAATTTCTTTGTTAACTGGAAAGCATCATCACCCAAGATAAATGAAGATGGGCGTATTTATATGGGAGACTACAAGAATGCTTATTATATCTATGAAGATACAATGGATTTGCAATACAAAGGTCTATTCATGGAGCAGGGGAAAGTCCTTACTTTCTACAGCACCATTGATTTCTCTGGAAACAAACTTGAAGGACAGATTCCTGAGTCTATTGGTCTGTTGAAGGAATTGATAGCGCTCAACTTATCGAACAACGCCTTCACTGGCCATATTCCTATGTCTTTGGCAAATGTTACGGAGCTCGAGTCACTAGACCTGTCAAGAAATCAACTATCAGGGAATATTCCAAGAGAACTCGGGAGCCTCTCATTTCTGGCGTACATAAGTGTAGCTCATAACCAACTCAAAGGTGAAATACCACAGGGACCACAGTTTAGTGGGCAAGCTGAATCATCATTTGAAGGGAATGTAGGTCTCTGTGGTCTTCCTCTCCAAGGAAGTTGCGTTGCGCCACCAACAAAATATCCCAAGGAAGAAGACGAAGAAGAAGAAGAGGACGAAGTGATTGAGTGGAAAGCAGTGTTTTTCGGGTATTGGCCTGGACTGTTACTTGGATTGGTAATGGCACACGTTATTGCTTCATTCAAGCCGAAGTGGTTTGTCAAGATACTTGGTCCAGCTAAGGGCAAGCAAGTAGATCCAGTTAGATTGTTTATGAATCTGGATTCAAGATGGGACAGTTTTAATAATAAGGATACTGTAGAAGAAGAAGTGATATGA


Protein sequences

Name Description Sequence
putative leucine-rich repeat disease resistance protein putative leucine-rich repeat disease resistance protein [Arabidopsis thaliana].

MRLHFCSLLLLYCIVFVSSFLTTDALACLPDQIQALIQFKNEFESDGCNRSDYLNGVQCDNTTGAVTKLQLPSGCFTGTLKPNSSLFELHQLRYLNLSHNNFTSSSLPSEFSNLTRLEVLSLASSSFTGQVPSSISNLILLTHLNLSHNELTGSFPPVRNLTKLSFLDLSYNQFSGAIPFDLLPTLPFLSYLDLKKNHLTGSIDVPNSSSSSKLVRLSLGFNQFEGKIIEPISKLINLNHLELASLNISHPIDLRVFAPLKSLLVFDIRQNRLLPASLSSDSEFPLSLISLILIQCDIIEFPNIFKTLQNLEHIDISNNLIKGKVPEWFWKLPRLSIANLVNNSLTGFEGSSEVLLNSSVQLLDFAYNSMTGAFPTPPLGSIYLSAWNNSFTGNIPLSICNRSSLIVLDLSYNKFTGPIPQCLSNLKVVNLRKNSLEGSIPDEFHSGAKTQTLDVGYNRLTGKLPKSLLNCSSLRFLSVDNNRIEDTFPFWLKALPNLHVLTLRSNRFFGHLSPPDRGPLAFPELRILELSDNSFTGSLPPNFFVNWKASSPKINEDGRIYMGDYKNAYYIYEDTMDLQYKGLFMEQGKVLTFYSTIDFSGNKLEGQIPESIGLLKELIALNLSNNAFTGHIPMSLANVTELESLDLSRNQLSGNIPRELGSLSFLAYISVAHNQLKGEIPQGPQFSGQAESSFEGNVGLCGLPLQGSCVAPPTKYPKEEDEEEEEDEVIEWKAVFFGYWPGLLLGLVMAHVIASFKPKWFVKILGPAKGKQVDPVRLFMNLDSRWDSFNNKDTVEEEVI


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420
1-710 PTHR24420,FAMILY NOT NAMED

MRLHFCSLLLLYCIVFVSSFLTTDALACLPDQIQALIQFKNEFESDGCNRSDYLNGVQCDNTTGAVTKLQLPSGCFTGTLKPNSSLFELHQLRYLNLSHNNFTSSSLPSEFSNLTRLEVLSLASSSFTGQVPSSISNLILLTHLNLSHNELTGSFPPVRNLTKLSFLDLSYNQFSGAIPFDLLPTLPFLSYLDLKKNHLTGSIDVPNSSSSSKLVRLSLGFNQFEGKIIEPISKLINLNHLELASLNISHPIDLRVFAPLKSLLVFDIRQNRLLPASLSSDSEFPLSLISLILIQCDIIEFPNIFKTLQNLEHIDISNNLIKGKVPEWFWKLPRLSIANLVNNSLTGFEGSSEVLLNSSVQLLDFAYNSMTGAFPTPPLGSIYLSAWNNSFTGNIPLSICNRSSLIVLDLSYNKFTGPIPQCLSNLKVVNLRKNSLEGSIPDEFHSGAKTQTLDVGYNRLTGKLPKSLLNCSSLRFLSVDNNRIEDTFPFWLKALPNLHVLTLRSNRFFGHLSPPDRGPLAFPELRILELSDNSFTGSLPPNFFVNWKASSPKINEDGRIYMGDYKNAYYIYEDTMDLQYKGLFMEQGKVLTFYSTIDFSGNKLEGQIPESIGLLKELIALNLSNNAFTGHIPMSLANVTELESLDLSRNQLSGNIPRELGSLSFLAYISVAHNQLKGEIPQGPQFSGQAESSFEGNVGLCGLPLQGSCV

HMMPanther: PTHR24420:SF473
1-710 PTHR24420:SF473,SUBFAMILY NOT NAMED

MRLHFCSLLLLYCIVFVSSFLTTDALACLPDQIQALIQFKNEFESDGCNRSDYLNGVQCDNTTGAVTKLQLPSGCFTGTLKPNSSLFELHQLRYLNLSHNNFTSSSLPSEFSNLTRLEVLSLASSSFTGQVPSSISNLILLTHLNLSHNELTGSFPPVRNLTKLSFLDLSYNQFSGAIPFDLLPTLPFLSYLDLKKNHLTGSIDVPNSSSSSKLVRLSLGFNQFEGKIIEPISKLINLNHLELASLNISHPIDLRVFAPLKSLLVFDIRQNRLLPASLSSDSEFPLSLISLILIQCDIIEFPNIFKTLQNLEHIDISNNLIKGKVPEWFWKLPRLSIANLVNNSLTGFEGSSEVLLNSSVQLLDFAYNSMTGAFPTPPLGSIYLSAWNNSFTGNIPLSICNRSSLIVLDLSYNKFTGPIPQCLSNLKVVNLRKNSLEGSIPDEFHSGAKTQTLDVGYNRLTGKLPKSLLNCSSLRFLSVDNNRIEDTFPFWLKALPNLHVLTLRSNRFFGHLSPPDRGPLAFPELRILELSDNSFTGSLPPNFFVNWKASSPKINEDGRIYMGDYKNAYYIYEDTMDLQYKGLFMEQGKVLTFYSTIDFSGNKLEGQIPESIGLLKELIALNLSNNAFTGHIPMSLANVTELESLDLSRNQLSGNIPRELGSLSFLAYISVAHNQLKGEIPQGPQFSGQAESSFEGNVGLCGLPLQGSCV

Gene3D: G3DSA:3.80.10.10
28-274 G3DSA:3.80.10.10

CLPDQIQALIQFKNEFESDGCNRSDYLNGVQCDNTTGAVTKLQLPSGCFTGTLKPNSSLFELHQLRYLNLSHNNFTSSSLPSEFSNLTRLEVLSLASSSFTGQVPSSISNLILLTHLNLSHNELTGSFPPVRNLTKLSFLDLSYNQFSGAIPFDLLPTLPFLSYLDLKKNHLTGSIDVPNSSSSSKLVRLSLGFNQFEGKIIEPISKLINLNHLELASLNISHPIDLRVFAPLKSLLVFDIRQNRLL

superfamily: SSF52058
50-375 SSF52058,LRR

RSDYLNGVQCDNTTGAVTKLQLPSGCFTGTLKPNSSLFELHQLRYLNLSHNNFTSSSLPSEFSNLTRLEVLSLASSSFTGQVPSSISNLILLTHLNLSHNELTGSFPPVRNLTKLSFLDLSYNQFSGAIPFDLLPTLPFLSYLDLKKNHLTGSIDVPNSSSSSKLVRLSLGFNQFEGKIIEPISKLINLNHLELASLNISHPIDLRVFAPLKSLLVFDIRQNRLLPASLSSDSEFPLSLISLILIQCDIIEFPNIFKTLQNLEHIDISNNLIKGKVPEWFWKLPRLSIANLVNNSLTGFEGSSEVLLNSSVQLLDFAYNSMTGAFP

HMMPfam: PF00560
IPR001611
91-114 LRR_1
Leucine-rich repeat

QLRYLNLSHNNFTSSSLPSEFSNL

ProfileScan: PS51450
IPR001611
91-111 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

QLRYLNLSHNNFTSSSLPSEF

ProfileScan: PS51450
IPR001611
140-162 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

LLTHLNLSHNELTGSFPPVRNLT

FPrintScan: PR00019
141-154 LEURICHRPT,Leucine-rich repeat signature

LTHLNLSHNELTGS

HMMPfam: PF12799
141-175 LRR_4,Leucine Rich repeats (2 copies)

LTHLNLSHNELTGSFPPVRNLTKLSFLDLSYNQFS

ProfileScan: PS51450
IPR001611
163-184 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLSFLDLSYNQFSGAIPFDLLP

ProfileScan: PS51450
IPR001611
188-210 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

FLSYLDLKKNHLTGSIDVPNSSS

ProfileScan: PS51450
IPR001611
213-236 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLVRLSLGFNQFEGKIIEPISKLI

HMMPfam: PF13855
288-345 LRR_8,Leucine rich repeat

LISLILIQCDIIEFPNIFKTLQNLEHIDISNNLIKGKVPEWFWKLPRLSIANLVNNSL

Gene3D: G3DSA:3.80.10.10
297-433 G3DSA:3.80.10.10

DIIEFPNIFKTLQNLEHIDISNNLIKGKVPEWFWKLPRLSIANLVNNSLTGFEGSSEVLLNSSVQLLDFAYNSMTGAFPTPPLGSIYLSAWNNSFTGNIPLSICNRSSLIVLDLSYNKFTGPIPQCLSNLKVVNLRK

ProfileScan: PS51450
IPR001611
310-331 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLEHIDISNNLIKGKVPEWFWK

ProfileScan: PS51450
IPR001611
334-355 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLSIANLVNNSLTGFEGSSEVL

superfamily: SSF52058
383-441 SSF52058,LRR

YLSAWNNSFTGNIPLSICNRSSLIVLDLSYNKFTGPIPQCLSNLKVVNLRKNSLEGSIP

ProfileScan: PS51450
IPR001611
404-427 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLIVLDLSYNKFTGPIPQCLSNLK

superfamily: SSF52058
424-709 SSF52058,LRR

SNLKVVNLRKNSLEGSIPDEFHSGAKTQTLDVGYNRLTGKLPKSLLNCSSLRFLSVDNNRIEDTFPFWLKALPNLHVLTLRSNRFFGHLSPPDRGPLAFPELRILELSDNSFTGSLPPNFFVNWKASSPKINEDGRIYMGDYKNAYYIYEDTMDLQYKGLFMEQGKVLTFYSTIDFSGNKLEGQIPESIGLLKELIALNLSNNAFTGHIPMSLANVTELESLDLSRNQLSGNIPRELGSLSFLAYISVAHNQLKGEIPQGPQFSGQAESSFEGNVGLCGLPLQGSC

HMMPfam: PF13855
424-484 LRR_8,Leucine rich repeat

SNLKVVNLRKNSLEGSIPDEFHSGAKTQTLDVGYNRLTGKLPKSLLNCSSLRFLSVDNNRI

Gene3D: G3DSA:3.80.10.10
434-551 G3DSA:3.80.10.10

NSLEGSIPDEFHSGAKTQTLDVGYNRLTGKLPKSLLNCSSLRFLSVDNNRIEDTFPFWLKALPNLHVLTLRSNRFFGHLSPPDRGPLAFPELRILELSDNSFTGSLPPNFFVNWKASS

ProfileScan: PS51450
IPR001611
473-494 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLRFLSVDNNRIEDTFPFWLKA

ProfileScan: PS51450
IPR001611
524-546 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ELRILELSDNSFTGSLPPNFFVN

HMMPfam: PF00560
IPR001611
525-545 LRR_1
Leucine-rich repeat

LRILELSDNSFTGSLPPNFFV

Gene3D: G3DSA:3.80.10.10
597-706 G3DSA:3.80.10.10

IDFSGNKLEGQIPESIGLLKELIALNLSNNAFTGHIPMSLANVTELESLDLSRNQLSGNIPRELGSLSFLAYISVAHNQLKGEIPQGPQFSGQAESSFEGNVGLCGLPLQ

ProfileScan: PS51450
IPR001611
617-640 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ELIALNLSNNAFTGHIPMSLANVT

FPrintScan: PR00019
639-652 LEURICHRPT,Leucine-rich repeat signature

VTELESLDLSRNQL

ProfileScan: PS51450
IPR001611
641-664 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ELESLDLSRNQLSGNIPRELGSLS

HMMPfam: PF00560
IPR001611
642-663 LRR_1
Leucine-rich repeat

LESLDLSRNQLSGNIPRELGSL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox