PRGDB00049139 (At2g24160)

From PRG Wiki
Jump to: navigation, search
At2g24160
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 25084282 (BT002201)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana putative disease resistance protein (At2g24160) mRNA, complete cds.

DNA Sequence

ATGAACTTCCGGAGACTTGAAAATATGAGGTCATGGAACAAGAGCAGTGATTGCTGTTCTTGGGAGTCTGTCACGTGTGATGCTAAATATGGCCAGGTGATTTCACTTTATCTTCTTGGCGTTAATCTTAACAACACTTTAAAACCAAATAGTGGTCTTTTCAAACTCCAATATCTCCAAAACCTAACCCTTCGTTATTGCAATCTCTATGGAGAGATTCCTTTTTCATTAGGAACCCTTTCTCATCTCACCTTTCTCGACCTTTCGGAAAATAAATTAGTTGGTCAAGTTCCATCTTCAATTGGAAACTTGACCAAACTAATGTACCTTCGCCTTTCCATAAACCACTTAAGTGGCAAATCTTCTGTTTCATTTGCCAATTTAACGAAATTGATCCAACTCGACATCAGAGAAAATGACTTTGAACCCGAGCTTATACCGGACATGAGCCGATTCCACAACTTGGAGGGATTTGGGGGTGGGAACTTTTTCGGGCCTTTTCCTACATCCTTGTTCACGATTCCTTCGTTACGATGGGTTAATTTGAGGGACAGTAACAACAACTTCACGGGACATATAGATTTTGGGAATTCGTCTTTATCTTCTAGGCTTTCTTATCTTAGTCTTGCTGATAACAATTTCGATGGCCCAATCCCTGAATCCATATCTAAATTTCTCAATCTCGTATTATTAGATCTTCGTAACAACTCATTTTCCGGGCCTTTCCCAACATCCTTGTTCAAGATTCCTTCGTTACAATGGGTTACTTTGGCGCGAAACAATTTCAAGGGACCTATAGATTTTGGGAATACATGGCCATCATCGTCTAGTCTTAGTAGTCTATACCTTGCTGATAACAATTTCGATGGCCAAATCCCAGAATCCATATCTCAATTTCTCAAACTCGAAAGGTTAGATATTTCCAACAATAAGTTGCAAGGCAATGTCCCAGGTTGCTTATTGAGATTGTCATCGCTAGAACTTTCTCACAACTCTTTGAGTGGTTTTGGAAAATCATCACAAGTTCTAGATCAAGCACAAATGCGAGTTTGCGTCTTGATTCTAATTCATTCCAAGGACCATTTCCACATTGGATCTGCCAGTTTAGATTGCTGGAGATTTTAG


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Arabidopsis thaliana].

MNFRRLENMRSWNKSSDCCSWESVTCDAKYGQVISLYLLGVNLNNTLKPNSGLFKLQYLQNLTLRYCNLYGEIPFSLGTLSHLTFLDLSENKLVGQVPSSIGNLTKLMYLRLSINHLSGKSSVSFANLTKLIQLDIRENDFEPELIPDMSRFHNLEGFGGGNFFGPFPTSLFTIPSLRWVNLRDSNNNFTGHIDFGNSSLSSRLSYLSLADNNFDGPIPESISKFLNLVLLDLRNNSFSGPFPTSLFKIPSLQWVTLARNNFKGPIDFGNTWPSSSSLSSLYLADNNFDGQIPESISQFLKLERLDISNNKLQGNVPGCLLRLSSLELSHNSLSGFGKSSQVLDQAQMRVCVLILIHSKDHFHIGSASLDCWRF


Domains

Domain Start-End Description Sequence

HMMPfam: PF08263
IPR013210
8-27 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

NMRSWNKSSDCCSWESVTCD

Gene3D: G3DSA:3.80.10.10
8-178 G3DSA:3.80.10.10

NMRSWNKSSDCCSWESVTCDAKYGQVISLYLLGVNLNNTLKPNSGLFKLQYLQNLTLRYCNLYGEIPFSLGTLSHLTFLDLSENKLVGQVPSSIGNLTKLMYLRLSINHLSGKSSVSFANLTKLIQLDIRENDFEPELIPDMSRFHNLEGFGGGNFFGPFPTSLFTIPSLR

HMMPanther: PTHR24420
9-335 PTHR24420,FAMILY NOT NAMED

MRSWNKSSDCCSWESVTCDAKYGQVISLYLLGVNLNNTLKPNSGLFKLQYLQNLTLRYCNLYGEIPFSLGTLSHLTFLDLSENKLVGQVPSSIGNLTKLMYLRLSINHLSGKSSVSFANLTKLIQLDIRENDFEPELIPDMSRFHNLEGFGGGNFFGPFPTSLFTIPSLRWVNLRDSNNNFTGHIDFGNSSLSSRLSYLSLADNNFDGPIPESISKFLNLVLLDLRNNSFSGPFPTSLFKIPSLQWVTLARNNFKGPIDFGNTWPSSSSLSSLYLADNNFDGQIPESISQFLKLERLDISNNKLQGNVPGCLLRLSSLELSHNSLSG

superfamily: SSF52058
17-337 SSF52058,LRR

DCCSWESVTCDAKYGQVISLYLLGVNLNNTLKPNSGLFKLQYLQNLTLRYCNLYGEIPFSLGTLSHLTFLDLSENKLVGQVPSSIGNLTKLMYLRLSINHLSGKSSVSFANLTKLIQLDIRENDFEPELIPDMSRFHNLEGFGGGNFFGPFPTSLFTIPSLRWVNLRDSNNNFTGHIDFGNSSLSSRLSYLSLADNNFDGPIPESISKFLNLVLLDLRNNSFSGPFPTSLFKIPSLQWVTLARNNFKGPIDFGNTWPSSSSLSSLYLADNNFDGQIPESISQFLKLERLDISNNKLQGNVPGCLLRLSSLELSHNSLSGFG

HMMPfam: PF13855
81-140 LRR_8,Leucine rich repeat

SHLTFLDLSENKLVGQVPSSIGNLTKLMYLRLSINHLSGKSSVSFANLTKLIQLDIREND

FPrintScan: PR00019
83-96 LEURICHRPT,Leucine-rich repeat signature

LTFLDLSENKLVGQ

Gene3D: G3DSA:3.80.10.10
179-338 G3DSA:3.80.10.10

WVNLRDSNNNFTGHIDFGNSSLSSRLSYLSLADNNFDGPIPESISKFLNLVLLDLRNNSFSGPFPTSLFKIPSLQWVTLARNNFKGPIDFGNTWPSSSSLSSLYLADNNFDGQIPESISQFLKLERLDISNNKLQGNVPGCLLRLSSLELSHNSLSGFGK

HMMPfam: PF00560
IPR001611
227-247 LRR_1
Leucine-rich repeat

NLVLLDLRNNSFSGPFPTSLF

HMMPfam: PF13516
276-298 LRR_6,Leucine Rich repeat

SSLSSLYLADNNFDGQIPESISQ

HMMPfam: PF00560
IPR001611
301-319 LRR_1
Leucine-rich repeat

KLERLDISNNKLQGNVPGC

FPrintScan: PR00019
320-333 LEURICHRPT,Leucine-rich repeat signature

LLRLSSLELSHNSL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox