PRGDB00049142 (putative TIR/NBS/LRR disease resistance protein)

From PRG Wiki
Jump to: navigation, search
putative TIR/NBS/LRR disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 21655260 (AY091557)
Gene Class Unknown
Domain Type LRR, LRR
Gene Species Pinus taeda

Comment?

Pinus taeda putative TIR/NBS/LRR disease resistance protein mRNA, partial cds.

DNA Sequence

CGGAATTTAAGTAGACTTCAATATCTCTCTTTAGCAGGATGCTCTAGCTTGACATTCTCAAGCATACATTGGAATATCAGGATGCTGAACTTTAGACCTTCAAATTGTCGGAGAATGGAAACATTGCCTCTCCAAGTCACAGTTCAGCGGTACCTGAAAGAATTAAATTTGAAGGATACCAGCATAACAGAATTGCCGATTGCCATTGGAAACCTAGGTAACTTGGAAATTCTGAGATTACAATGCCGTTCCTTAGAAATGCTGCCCCTGGGTGGACTAAGTAGCTTGAGAGAATTGACACTCCAGTTCTGCGACAAATTGAGACAACTGCCCGAGTCGGTTGGAGAATTGACACATTTGACAACCCTGATCATACATTATGCACAGATAAAGTATTTACCAGCAGCTGTCATGCGGTTGAACAATCTTGAAATTTTGAAAGTCAGAGGTTGTCCGCTACTTGAAGTGCCATTTAATCCGCGGGATTCATCTATTGACAAGATCTGCATGGTTGGACTCAGACAGATGGACCTACAGGTGACGAGACTAAAGGAGCTATCATTTTGCAAAGGGGTATGCCCCAACCTTCAACGCCTCAATGTCAGCTATTGTCATGAACTAGTGGTGGTGGGAGCATTGCCAACATCACTAATATCTCTGGACCTGCAGGAATGTCGTGCATTGAAGGAAATATTAGGGCTTTCAGGACTTCAACAGCTTCGACTCCTGGACATCAGCGGGTGTGACAAGATAGAGGAGATGCCAGGTGTTGACACCTTGGGTTCTTTGATCCACTTGCGGGCAGATGGATGCAACAAGGTGGACCGCGTAGAGAAAATTGGTCTGAAGATAAAAAGAATATCACGGGACTCTTGTGATGTAAGTAGTGGAAAGAAACTAAGACAATGA


Protein sequences

Name Description Sequence
putative TIR/NBS/LRR disease resistance protein putative TIR/NBS/LRR disease resistance protein [Pinus taeda].

RNLSRLQYLSLAGCSSLTFSSIHWNIRMLNFRPSNCRRMETLPLQVTVQRYLKELNLKDTSITELPIAIGNLGNLEILRLQCRSLEMLPLGGLSSLRELTLQFCDKLRQLPESVGELTHLTTLIIHYAQIKYLPAAVMRLNNLEILKVRGCPLLEVPFNPRDSSIDKICMVGLRQMDLQVTRLKELSFCKGVCPNLQRLNVSYCHELVVVGALPTSLISLDLQECRALKEILGLSGLQQLRLLDISGCDKIEEMPGVDTLGSLIHLRADGCNKVDRVEKIGLKIKRISRDSCDVSSGKKLRQ

Domains

Domain Start-End Description Sequence

HMMPanther: PTHR23155:SF252
2-272 PTHR23155:SF252,SUBFAMILY NOT NAMED

NLSRLQYLSLAGCSSLTFSSIHWNIRMLNFRPSNCRRMETLPLQVTVQRYLKELNLKDTSITELPIAIGNLGNLEILRLQCRSLEMLPLGGLSSLRELTLQFCDKLRQLPESVGELTHLTTLIIHYAQIKYLPAAVMRLNNLEILKVRGCPLLEVPFNPRDSSIDKICMVGLRQMDLQVTRLKELSFCKGVCPNLQRLNVSYCHELVVVGALPTSLISLDLQECRALKEILGLSGLQQLRLLDISGCDKIEEMPGVDTLGSLIHLRADGCN

HMMPanther: PTHR23155
2-272 PTHR23155,LRR,LEUCINE-RICH REPEAT-CONTAINING PROTEIN

NLSRLQYLSLAGCSSLTFSSIHWNIRMLNFRPSNCRRMETLPLQVTVQRYLKELNLKDTSITELPIAIGNLGNLEILRLQCRSLEMLPLGGLSSLRELTLQFCDKLRQLPESVGELTHLTTLIIHYAQIKYLPAAVMRLNNLEILKVRGCPLLEVPFNPRDSSIDKICMVGLRQMDLQVTRLKELSFCKGVCPNLQRLNVSYCHELVVVGALPTSLISLDLQECRALKEILGLSGLQQLRLLDISGCDKIEEMPGVDTLGSLIHLRADGCN

superfamily: SSF52058
2-283 SSF52058,LRR

NLSRLQYLSLAGCSSLTFSSIHWNIRMLNFRPSNCRRMETLPLQVTVQRYLKELNLKDTSITELPIAIGNLGNLEILRLQCRSLEMLPLGGLSSLRELTLQFCDKLRQLPESVGELTHLTTLIIHYAQIKYLPAAVMRLNNLEILKVRGCPLLEVPFNPRDSSIDKICMVGLRQMDLQVTRLKELSFCKGVCPNLQRLNVSYCHELVVVGALPTSLISLDLQECRALKEILGLSGLQQLRLLDISGCDKIEEMPGVDTLGSLIHLRADGCNKVDRVEKIGLK

Gene3D: G3DSA:3.80.10.10
3-190 G3DSA:3.80.10.10

LSRLQYLSLAGCSSLTFSSIHWNIRMLNFRPSNCRRMETLPLQVTVQRYLKELNLKDTSITELPIAIGNLGNLEILRLQCRSLEMLPLGGLSSLRELTLQFCDKLRQLPESVGELTHLTTLIIHYAQIKYLPAAVMRLNNLEILKVRGCPLLEVPFNPRDSSIDKICMVGLRQMDLQVTRLKELSFCK

HMMPfam: PF13504
4-18 LRR_7,Leucine rich repeat

SRLQYLSLAGCSSLT

HMMPfam: PF13504
51-66 LRR_7,Leucine rich repeat

YLKELNLKDTSITELP

HMMPfam: PF13504
94-111 LRR_7,Leucine rich repeat

SSLRELTLQFCDKLRQLP

Gene3D: G3DSA:3.80.10.10
191-272 G3DSA:3.80.10.10

GVCPNLQRLNVSYCHELVVVGALPTSLISLDLQECRALKEILGLSGLQQLRLLDISGCDKIEEMPGVDTLGSLIHLRADGCN

HMMPfam: PF13504
194-207 LRR_7,Leucine rich repeat

PNLQRLNVSYCHEL


List of References

Blake C Meyers, Michele Morgante, Richard W Michelmore
TIR-X and TIR-NBS proteins: two new families related to disease resistance TIR-NBS-LRR proteins encoded in Arabidopsis and other plant genomes.
Plant J.: 2002, 32(1);77-92
PubMed:12366802 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox