PRGDB00049143 (putative TIR/NBS/LRR disease resistance protein)

From PRG Wiki
Jump to: navigation, search
putative TIR/NBS/LRR disease resistance protein
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 21655259 (AY091556)
Gene Class N
Domain Type TIR, NBS, LRR
Gene Species Pinus taeda

Comment?

Pinus taeda putative TIR/NBS/LRR disease resistance protein mRNA, partial cds.

DNA Sequence

CTACCGTCCATCTTCATCATCTTGTTTCACCGCTGTATCCAATCTCTAATGGCTTCATCTTCCGCCTCCACCTCCACCTCCCGACGTTACGCTTACGATGTCTTCATTAACTGCTCCAGTTCCGATGACAGTAGTAAATTCGCTGCTCATCTTTGCCGGAGACTTATAAGCTACGGATTGAGAGCCTTCTTGGACAATCGGGAGATGTTCGATTCGGACGGCCTCCCGAAATTGCAGACAGAAATCGCGATTCGAACGGCCTCCGTCTGCGTACCCATTTTCTCCCCGCGATACGCGGAATCGATACGGTGTCTCAATGAGCTCCTCCTGATGCTGGAGTCGGGGGCTACCATTATTCCCGTCTTCCACCATATGACACCTGCTGAGCTTCGATGGACGCGGAACGGCGATGGAGTGTTTGCTCAAGCCCCGTGCAATCTCGAAGAGGAGAAAGTATACGACCCTCAAACTCATGATATGAGACAGAGATATGAGTCTAACACCATTGAACATTGGAGAAAATCCCTTTCTCATGTTTCATCTTTGTCAGGTTTTGAGCTAGACGCGTTTAATGGAGACGAAGGGGAATTGCTTGATAAACTAGTAAATTATGTCTTGAGAAAGGGCAAAAGACTACTAAATGTAGCCACATTTCCAACTGGGTTGGATGAAAAAGTGAGAGATTTTGAATATAAAGTTTTATTGCCTGGAAAACCTAGCGTTGTAGGGATCGTTGGGAGTGGTGGTGTAGGAAAGTCAACCCTGGCCAAAGAACTCTTTAATAGGATGAGTTCAACTTACAGTAGATCCTGCTTTCTACGTGATGTGAGAGAAAGTGCAAACAGGCGCTCTCTAATTCATTGCAGAAGGAAT


Protein sequences

Name Description Sequence
putative TIR/NBS/LRR disease resistance protein putative TIR/NBS/LRR disease resistance protein [Pinus taeda].

LPSIFIILFHRCIQSLMASSSASTSTSRRYAYDVFINCSSSDDSSKFAAHLCRRLISYGLRAFLDNREMFDSDGLPKLQTEIAIRTASVCVPIFSPRYAESIRCLNELLLMLESGATIIPVFHHMTPAELRWTRNGDGVFAQAPCNLEEEKVYDPQTHDMRQRYESNTIEHWRKSLSHVSSLSGFELDAFNGDEGELLDKLVNYVLRKGKRLLNVATFPTGLDEKVRDFEYKVLLPGKPSVVGIVGSGGVGKSTLAKELFNRMSSTYSRSCFLRDVRESANRRSLIHCRRN

Domains

Domain Start-End Description Sequence

superfamily: SSF52200
IPR000157
20-185 TIR
Toll/interleukin-1 receptor homology (TIR) domain

SSASTSTSRRYAYDVFINCSSSDDSSKFAAHLCRRLISYGLRAFLDNREMFDSDGLPKLQTEIAIRTASVCVPIFSPRYAESIRCLNELLLMLESGATIIPVFHHMTPAELRWTRNGDGVFAQAPCNLEEEKVYDPQTHDMRQRYESNTIEHWRKSLSHVSSLSGF

Gene3D: G3DSA:3.40.50.10140
28-174 G3DSA:3.40.50.10140

RRYAYDVFINCSSSDDSSKFAAHLCRRLISYGLRAFLDNREMFDSDGLPKLQTEIAIRTASVCVPIFSPRYAESIRCLNELLLMLESGATIIPVFHHMTPAELRWTRNGDGVFAQAPCNLEEEKVYDPQTHDMRQRYESNTIEHWRK

ProfileScan: PS50104
IPR000157
30-182 TIR
Toll/interleukin-1 receptor homology (TIR) domain

YAYDVFINCSSSDDSSKFAAHLCRRLISYGLRAFLDNREMFDSDGLPKLQTEIAIRTASVCVPIFSPRYAESIRCLNELLLMLESGATIIPVFHHMTPAELRWTRNGDGVFAQAPCNLEEEKVYDPQTHDMRQRYESNTIEHWRKSLSHVSSL

HMMPfam: PF13676
34-126 TIR_2,TIR domain

VFINCSSSDDSSKFAAHLCRRLISYGLRAFLDNREMFDSDGLPKLQTEIAIRTASVCVPIFSPRYAESIRCLNELLLMLESGATIIPVFHHMT

Gene3D: G3DSA:3.40.50.300
236-265 G3DSA:3.40.50.300

PGKPSVVGIVGSGGVGKSTLAKELFNRMSS

superfamily: SSF52540
236-273 SSF52540

PGKPSVVGIVGSGGVGKSTLAKELFNRMSSTYSRSCFL

HMMPfam: PF00931
IPR002182
238-279 NB-ARC,NBS
NB-ARC

KPSVVGIVGSGGVGKSTLAKELFNRMSSTYSRSCFLRDVRES


List of References

Blake C Meyers, Michele Morgante, Richard W Michelmore
TIR-X and TIR-NBS proteins: two new families related to disease resistance TIR-NBS-LRR proteins encoded in Arabidopsis and other plant genomes.
Plant J.: 2002, 32(1);77-92
PubMed:12366802 WorldCat.org (P p)





List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox