PRGDB00049145 (At4g13900)

From PRG Wiki
Jump to: navigation, search
At4g13900
Gene Type Putative_R-Genes,_collected_from_NCBI_Protein
GenBank 23306431 (BT000466)
Gene Class Unknown
Domain Type LRR, LRR, Ser-Thr Kinase, Ser-Thr Kinase
Gene Species Arabidopsis thaliana

Comment?

Arabidopsis thaliana putative disease resistance protein (At4g13900) mRNA, complete cds.

DNA Sequence

ATGATGTATTCTTGTAGAGAGAGGAGGATGATAACAGTAAAATGGAGCTTGTGTTTAATCTTCTGCCTTTCAAACTCAATACTTGTTTTTGCTAAACACTTGTGTCTTCCAGACCAGAGGGATTCTCTTTGGGGGTTCAAGAACGAATTCCATGTCCCAAGCGAGAAGTGGAGGAACAACACTGATTGCTGTTCTTGGGATGGTGTTTCTTGTGATCCTAAGACGGGCAATGTCGTTGGGTTAGATCTAGCGGGCAGTGATCTCAATGGCCCTTTGAGATCTAATAGCAGCCTGTTTAGACTACAACATCTTCAGAAGCTGTATCTTGGTTGTAATACTTCATTCGGAAGTCTTTCTTATAATGATGGTTTGAAGGGTGGTGAGCTACTGGATTCCATCGGCAACCTCAAATATTTGAAGGTTTTGAGTCTTCGTGGTTGCAATCTCTTTGGAAAGATTCCTTCTTCACTCGGAAATCTTTCTTATCTCACTCATCTTGATCTTTCTTTTAATGATTTCACCGGTGTGATACCAGATTCGATGGGCAATCTCAACTATTTGAGGGTTTTGAATCTTGGTAAATGCAATTTCTATGGAAAGGTTCCTTCTTCACTCGGAAATCTTTCTTATCTCGCTCAACTTGATCTTTCCTATAATGATTTCACCCGTGAAGGACCAGATTCAATGGGGAACCTTAACCGACTAACCGATATGCTTCTCAAGTTGAACTCGCTCACCGATATCGACCTTGGTTCTAACCAGTTGAAAGGGATTAATTTGAAGATCAGTTCAACCGTCAGTCTTCCCTCACCCATAGAATACTTGGTTTTATCGTCGTGTAATATTTCCGAGTTTCCCAAATTTCTACGTAACCAAACCAAGTTGTATTCTTTAGACATCTCTGCCAATCAAATTGAAGGCCAAGTACCGGAGTGGTTATGGAGTCTGCCAGAGTTGCAGTCTATTAACATCTCTCATAATTCTTTCAATGGTTTCGAAGGACCAGCAGATGTTATTCAAGGAGGTGGAGAACTATATATGCTTGACATAAGTTCAAACATATTCCAGGATCCATTTCCTTTGTTACCAGTAGACTCTATGAATTTCTTGTTCAGCTCCAATAATCGATTTTCGGGAGAGATTCCTAAAACAATATGCGAATTGGATAATCTTGTGATGCTTGTTTTGTCAAACAACAACTTCAGCGGTTCTATTCCTCGGTGTTTTGAGAATTTACATCTTTATGTCTTGCATCTTCGGAATAACAACCTCTCTGGTATTTTTCCAGAGGAAGCTATCAGTGATCGCTTGCAATCACTTGATGTTGGTCACAATCTTTTCTCAGGAGAACTTCCCAAATCATTGATCAACTGCAGTGCACTCGAGTTTCTATACGTGGAAGATAACCGAATCAGTGACACGTTTCCATCCTGGTTGGAATTGTTGCCCAATTTTCAGATTCTTGTCCTTCGTTCTAACGAGTTCTATGGGCCAATATTTTCTCCTGGAGATTCTTTGAGTTTCCCCAGGTTGCGAATCTTTGATATTTCGGAAAATCGCTTCACTGGAGTCTTGCCATCAGATTACTTTGCGCCTTGGAGTGCAATGTCGTCAGTCGTGGATAGAATAATTCAGCATTTTTTCCAGGGATACTATCATAACTCTGTGGTTCTGACGAACAAAGGATTAAATATGGAGCTGGTTGGGAGTGGTTTCACAATCTACAAAACCATTGATGTCTCCGGAAACAGACTCGAAGGAGACATCCCCGAGTCCATCAGTCTTCTCAAGGAACTGATTGTGCTCAACATGTCAAACAACGCTTTCACAGGCCATATTCCACCATCTCTATCAAACTTGAGCAATCTCCAATCATTGGATCTATCTCAAAACAGATTATCCGGCAGTATCCCAGGAGAGCTCGGGGAACTCACATTTCTAGCGCGGATGAACTTCTCTTACAACAGGCTTGAAGGTCCAATACCACAAACCACTCAGATTCAAACCCAGGATAGTTCTTCTTTCACAGAGAATCCTGGACTCTGTGGTCTTCCTCTAAAAAAAAACTGCGGCGGAAAAGAAGAAGCAACAAAGCAAGAGCAAGATGAGGAAAAGGAAGAAGAAGAACAAGTATTTAGCTGGATCGCAGCTGCAATAGGCTACGTACCTGGTGTTGTGTGTGGACTCACCATCGGCCACATTCTGGTTTCACACAAACGTGACTGGTTCATGAGAATTGTTTCCCTCTTTACTTAA


Protein sequences

Name Description Sequence
putative disease resistance protein putative disease resistance protein [Arabidopsis thaliana].

MMYSCRERRMITVKWSLCLIFCLSNSILVFAKHLCLPDQRDSLWGFKNEFHVPSEKWRNNTDCCSWDGVSCDPKTGNVVGLDLAGSDLNGPLRSNSSLFRLQHLQKLYLGCNTSFGSLSYNDGLKGGELLDSIGNLKYLKVLSLRGCNLFGKIPSSLGNLSYLTHLDLSFNDFTGVIPDSMGNLNYLRVLNLGKCNFYGKVPSSLGNLSYLAQLDLSYNDFTREGPDSMGNLNRLTDMLLKLNSLTDIDLGSNQLKGINLKISSTVSLPSPIEYLVLSSCNISEFPKFLRNQTKLYSLDISANQIEGQVPEWLWSLPELQSINISHNSFNGFEGPADVIQGGGELYMLDISSNIFQDPFPLLPVDSMNFLFSSNNRFSGEIPKTICELDNLVMLVLSNNNFSGSIPRCFENLHLYVLHLRNNNLSGIFPEEAISDRLQSLDVGHNLFSGELPKSLINCSALEFLYVEDNRISDTFPSWLELLPNFQILVLRSNEFYGPIFSPGDSLSFPRLRIFDISENRFTGVLPSDYFAPWSAMSSVVDRIIQHFFQGYYHNSVVLTNKGLNMELVGSGFTIYKTIDVSGNRLEGDIPESISLLKELIVLNMSNNAFTGHIPPSLSNLSNLQSLDLSQNRLSGSIPGELGELTFLARMNFSYNRLEGPIPQTTQIQTQDSSSFTENPGLCGLPLKKNCGGKEEATKQEQDEEKEEEEQVFSWIAAAIGYVPGVVCGLTIGHILVSHKRDWFMRIVSLFT


Domains

Domain Start-End Description Sequence

HMMPanther: PTHR24420:SF911
5-744 PTHR24420:SF911

CRERRMITVKWSLCLIFCLSNSILVFAKHLCLPDQRDSLWGFKNEFHVPSEKWRNNTDCCSWDGVSCDPKTGNVVGLDLAGSDLNGPLRSNSSLFRLQHLQKLYLGCNTSFGSLSYNDGLKGGELLDSIGNLKYLKVLSLRGCNLFGKIPSSLGNLSYLTHLDLSFNDFTGVIPDSMGNLNYLRVLNLGKCNFYGKVPSSLGNLSYLAQLDLSYNDFTREGPDSMGNLNRLTDMLLKLNSLTDIDLGSNQLKGINLKISSTVSLPSPIEYLVLSSCNISEFPKFLRNQTKLYSLDISANQIEGQVPEWLWSLPELQSINISHNSFNGFEGPADVIQGGGELYMLDISSNIFQDPFPLLPVDSMNFLFSSNNRFSGEIPKTICELDNLVMLVLSNNNFSGSIPRCFENLHLYVLHLRNNNLSGIFPEEAISDRLQSLDVGHNLFSGELPKSLINCSALEFLYVEDNRISDTFPSWLELLPNFQILVLRSNEFYGPIFSPGDSLSFPRLRIFDISENRFTGVLPSDYFAPWSAMSSVVDRIIQHFFQGYYHNSVVLTNKGLNMELVGSGFTIYKTIDVSGNRLEGDIPESISLLKELIVLNMSNNAFTGHIPPSLSNLSNLQSLDLSQNRLSGSIPGELGELTFLARMNFSYNRLEGPIPQTTQIQTQDSSSFTENPGLCGLPLKKNCGGKEEATKQEQDEEKEEEEQVFSWIAAAIGYVPGVVCGLTIGHILVSHKRDWFM

HMMPanther: PTHR24420
5-744 PTHR24420,FAMILY NOT NAMED

CRERRMITVKWSLCLIFCLSNSILVFAKHLCLPDQRDSLWGFKNEFHVPSEKWRNNTDCCSWDGVSCDPKTGNVVGLDLAGSDLNGPLRSNSSLFRLQHLQKLYLGCNTSFGSLSYNDGLKGGELLDSIGNLKYLKVLSLRGCNLFGKIPSSLGNLSYLTHLDLSFNDFTGVIPDSMGNLNYLRVLNLGKCNFYGKVPSSLGNLSYLAQLDLSYNDFTREGPDSMGNLNRLTDMLLKLNSLTDIDLGSNQLKGINLKISSTVSLPSPIEYLVLSSCNISEFPKFLRNQTKLYSLDISANQIEGQVPEWLWSLPELQSINISHNSFNGFEGPADVIQGGGELYMLDISSNIFQDPFPLLPVDSMNFLFSSNNRFSGEIPKTICELDNLVMLVLSNNNFSGSIPRCFENLHLYVLHLRNNNLSGIFPEEAISDRLQSLDVGHNLFSGELPKSLINCSALEFLYVEDNRISDTFPSWLELLPNFQILVLRSNEFYGPIFSPGDSLSFPRLRIFDISENRFTGVLPSDYFAPWSAMSSVVDRIIQHFFQGYYHNSVVLTNKGLNMELVGSGFTIYKTIDVSGNRLEGDIPESISLLKELIVLNMSNNAFTGHIPPSLSNLSNLQSLDLSQNRLSGSIPGELGELTFLARMNFSYNRLEGPIPQTTQIQTQDSSSFTENPGLCGLPLKKNCGGKEEATKQEQDEEKEEEEQVFSWIAAAIGYVPGVVCGLTIGHILVSHKRDWFM

superfamily: SSF52058
33-112 SSF52058,LRR

HLCLPDQRDSLWGFKNEFHVPSEKWRNNTDCCSWDGVSCDPKTGNVVGLDLAGSDLNGPLRSNSSLFRLQHLQKLYLGCN

Gene3D: G3DSA:3.80.10.10
35-250 G3DSA:3.80.10.10

CLPDQRDSLWGFKNEFHVPSEKWRNNTDCCSWDGVSCDPKTGNVVGLDLAGSDLNGPLRSNSSLFRLQHLQKLYLGCNTSFGSLSYNDGLKGGELLDSIGNLKYLKVLSLRGCNLFGKIPSSLGNLSYLTHLDLSFNDFTGVIPDSMGNLNYLRVLNLGKCNFYGKVPSSLGNLSYLAQLDLSYNDFTREGPDSMGNLNRLTDMLLKLNSLTDIDL

HMMPfam: PF08263
IPR013210
37-72 LRRNT_2
Leucine-rich repeat-containing N-terminal, type 2

PDQRDSLWGFKNEFHVPSEKWRNNTDCCSWDGVSCD

ProfileScan: PS51450
IPR001611
103-125 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLQKLYLGCNTSFGSLSYNDGLK

superfamily: SSF52058
117-365 SSF52058,LRR

SLSYNDGLKGGELLDSIGNLKYLKVLSLRGCNLFGKIPSSLGNLSYLTHLDLSFNDFTGVIPDSMGNLNYLRVLNLGKCNFYGKVPSSLGNLSYLAQLDLSYNDFTREGPDSMGNLNRLTDMLLKLNSLTDIDLGSNQLKGINLKISSTVSLPSPIEYLVLSSCNISEFPKFLRNQTKLYSLDISANQIEGQVPEWLWSLPELQSINISHNSFNGFEGPADVIQGGGELYMLDISSNIFQDPFPLLPVD

HMMPfam: PF00560
IPR001611
139-160 LRR_1
Leucine-rich repeat

LKVLSLRGCNLFGKIPSSLGNL

ProfileScan: PS51450
IPR001611
162-184 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

YLTHLDLSFNDFTGVIPDSMGNL

HMMPfam: PF13855
162-220 LRR_8,Leucine rich repeat

YLTHLDLSFNDFTGVIPDSMGNLNYLRVLNLGKCNFYGKVPSSLGNLSYLAQLDLSYND

FPrintScan: PR00019
163-176 LEURICHRPT,Leucine-rich repeat signature

LTHLDLSFNDFTGV

ProfileScan: PS51450
IPR001611
244-265 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

SLTDIDLGSNQLKGINLKISST

Gene3D: G3DSA:3.80.10.10
251-431 G3DSA:3.80.10.10

GSNQLKGINLKISSTVSLPSPIEYLVLSSCNISEFPKFLRNQTKLYSLDISANQIEGQVPEWLWSLPELQSINISHNSFNGFEGPADVIQGGGELYMLDISSNIFQDPFPLLPVDSMNFLFSSNNRFSGEIPKTICELDNLVMLVLSNNNFSGSIPRCFENLHLYVLHLRNNNLSGIFPEE

ProfileScan: PS51450
IPR001611
271-292 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

PIEYLVLSSCNISEFPKFLRNQ

HMMPfam: PF13855
272-328 LRR_8,Leucine rich repeat

IEYLVLSSCNISEFPKFLRNQTKLYSLDISANQIEGQVPEWLWSLPELQSINISHNS

ProfileScan: PS51450
IPR001611
294-317 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

KLYSLDISANQIEGQVPEWLWSLP

ProfileScan: PS51450
IPR001611
318-339 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ELQSINISHNSFNGFEGPADVI

superfamily: SSF52058
334-678 SSF52058,LRR

GPADVIQGGGELYMLDISSNIFQDPFPLLPVDSMNFLFSSNNRFSGEIPKTICELDNLVMLVLSNNNFSGSIPRCFENLHLYVLHLRNNNLSGIFPEEAISDRLQSLDVGHNLFSGELPKSLINCSALEFLYVEDNRISDTFPSWLELLPNFQILVLRSNEFYGPIFSPGDSLSFPRLRIFDISENRFTGVLPSDYFAPWSAMSSVVDRIIQHFFQGYYHNSVVLTNKGLNMELVGSGFTIYKTIDVSGNRLEGDIPESISLLKELIVLNMSNNAFTGHIPPSLSNLSNLQSLDLSQNRLSGSIPGELGELTFLARMNFSYNRLEGPIPQTTQIQTQDSSSFTEN

ProfileScan: PS51450
IPR001611
390-412 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLVMLVLSNNNFSGSIPRCFENL

HMMPfam: PF00560
IPR001611
390-412 LRR_1
Leucine-rich repeat

NLVMLVLSNNNFSGSIPRCFENL

ProfileScan: PS51450
IPR001611
413-434 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

HLYVLHLRNNNLSGIFPEEAIS

Gene3D: G3DSA:3.80.10.10
436-538 G3DSA:3.80.10.10

RLQSLDVGHNLFSGELPKSLINCSALEFLYVEDNRISDTFPSWLELLPNFQILVLRSNEFYGPIFSPGDSLSFPRLRIFDISENRFTGVLPSDYFAPWSAMSS

ProfileScan: PS51450
IPR001611
436-459 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

RLQSLDVGHNLFSGELPKSLINCS

ProfileScan: PS51450
IPR001611
460-482 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ALEFLYVEDNRISDTFPSWLELL

ProfileScan: PS51450
IPR001611
574-596 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

IYKTIDVSGNRLEGDIPESISLL

HMMPfam: PF13855
576-633 LRR_8,Leucine rich repeat

KTIDVSGNRLEGDIPESISLLKELIVLNMSNNAFTGHIPPSLSNLSNLQSLDLSQNRL

Gene3D: G3DSA:3.80.10.10
578-687 G3DSA:3.80.10.10

IDVSGNRLEGDIPESISLLKELIVLNMSNNAFTGHIPPSLSNLSNLQSLDLSQNRLSGSIPGELGELTFLARMNFSYNRLEGPIPQTTQIQTQDSSSFTENPGLCGLPLK

ProfileScan: PS51450
IPR001611
598-621 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

ELIVLNMSNNAFTGHIPPSLSNLS

FPrintScan: PR00019
620-633 LEURICHRPT,Leucine-rich repeat signature

LSNLQSLDLSQNRL

ProfileScan: PS51450
IPR001611
622-644 LRR,Leucine-rich repeat profile.
Leucine-rich repeat

NLQSLDLSQNRLSGSIPGELGEL






List of Contributions

There has not been any contribution yet.


Analyses

Blast

Blast matches against Reference R-Genes. Show


Personal tools
Namespaces

Variants
Actions
PRGDB
META-SPECIES
Wiki
Toolbox